Sequence of DPV Grapevine Algerian latent virus

Grapevine Algerian latent virus isolate Lim 4 coat protein gene, complete cds.

ACC No: AY500884

Dated: 2005-02-14 | Length: 1225 | CRC: 290597810

                !!NA_SEQUENCE 1.0
ID   AY500884   standard; genomic RNA; VRL; 1225 BP.
XX
AC   AY500884;
XX
SV   AY500884.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 3)
XX
DE   Grapevine Algerian latent virus isolate Lim 4 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Grapevine Algerian latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1225
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1225
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1225
FT                   /db_xref="taxon:208084"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine Algerian latent virus"
FT                   /isolate="Lim 4"
FT   CDS             45. .1175
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS4"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/TrEMBL:Q64IS4"
FT                   /product="coat protein"
FT                   /protein_id="AAT00606.2"
FT                   /translation="MALALNTRRNNNGKVMEMLAYKAAAAGAELALANVGSLTRGVAQL
FT                   GKSVMGKKKRNKNVSQVGALGGAVVAPVAVTRQIRGSKPRFSGRGTGSITVTHREYLGQ
FT                   VVTTADLQVNGGVTGNLLKVNPLNGILFSWLPTIAAGYDQCAFNRLSLQYVPLCATTAT
FT                   GRVAMYWDKDSTDLEPTDRVELANQAILKETSPWAEANLTVPTDRIKRFCDDSVVADRK
FT                   LVDLGQLGVATYGGTAVVAGDVFVSYTVTFYNPQPLSTLMDTTRIDTSNAVITNVGPQY
FT                   TRVDVVSGNQWLLTFRGVGKFVIFGSIRGTGAIALGLSGVIVNSSTTLTTPTGAMYVAN
FT                   VTVSSLPAGVSYTMTTVTAGLHSAVRATRANDMGTP"
XX
SQ   Sequence 1225 BP; 327 A; 282 C; 322 G; 294 T; 0 other;

AY500884  Length: 1225  February 22, 2005 08:35  Type: N  Check: 7879  ..

       1  cccagtatcc ttgactccgc cgtagcttga ccaaatatac acaaatggca
      51  ttagcactaa atacaagacg gaacaataac ggtaaagtga tggaaatgtt
     101  agcatataaa gcggctgcgg ctggcgctga gttggctctt gccaatgtcg
     151  gcagcttaac tcgcggtgtg gcacaattgg gtaagagtgt gatgggaaag
     201  aagaagagga ataagaatgt atcccaagtg ggtgcactag gtggggcagt
     251  tgtggcccct gtggcggtta ccagacaaat acgtgggtct aaacccaggt
     301  tttccggcag gggaactggt agcatcactg ttacacatag agaatacttg
     351  ggccaggtag tcacgacggc tgacctacaa gtgaacggag gcgttacggg
     401  caacctactg aaggtaaatc cattgaatgg aatactcttc tcctggttac
     451  caactattgc agccggttac gaccagtgcg cctttaacag gttatcattg
     501  cagtatgtac ccttgtgtgc aactacagcg actggtcgtg tagcgatgta
     551  ttgggataag gattctacgg atctggaacc cactgatcga gtcgaattgg
     601  ccaatcaagc aatcttgaaa gagacgtcgc catgggcaga agcaaactta
     651  actgtaccta ctgatcgcat caagagattc tgcgatgata gtgtggtcgc
     701  agaccgcaaa ctcgttgatc tcggacaact tggagtggct acatatggcg
     751  gaacagcggt ggttgccggg gatgtgtttg tcagttatac tgtcacattc
     801  tataatccac agcctctgtc caccctcatg gacaccacgc gtatcgacac
     851  ctcaaacgct gtaattacta atgtgggacc acagtataca cgggttgatg
     901  tagtatcagg caaccaatgg ctgttaacct ttcggggtgt cggcaagttt
     951  gtcatattcg gtagtatacg tggcactggg gccatcgctt taggtctgag
    1001  tggggttatc gttaactctt ccactaccct taccacaccc acgggagcaa
    1051  tgtatgtggc taacgtaacc gtatcatcat taccggcagg cgtatcatac
    1101  accatgacca ctgtcacagc tggattacat tcagctgtcc gcgcgacaag
    1151  ggcaaatgat atgggcacac cttagtgcat gccatgcaag aaaggggctt
    1201  cttgaacaag accagttcat ggaca