Sequence of DPV Cymbidium ringspot virus

Cymbidium ringspot virus isolate Lim 5 coat protein gene, complete cds.

ACC No: AY500885

Dated: 2005-02-14 | Length: 1194 | CRC: -1951634213

                !!NA_SEQUENCE 1.0
ID   AY500885   standard; genomic RNA; VRL; 1194 BP.
XX
AC   AY500885;
XX
SV   AY500885.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 3)
XX
DE   Cymbidium ringspot virus isolate Lim 5 coat protein gene, complete cds.
XX
KW   .
XX
OS   Cymbidium ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1194
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1194
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1194
FT                   /db_xref="taxon:12144"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cymbidium ringspot virus"
FT                   /isolate="Lim 5"
FT   CDS             12. .1148
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS3"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/TrEMBL:Q64IS3"
FT                   /product="coat protein"
FT                   /protein_id="AAT00607.2"
FT                   /translation="MALTTTNNNRAMARAAKQALPALGALATSGVGQQMFMSGVNYAIE
FT                   KGKQFVNNRRKGRKQSDMVLHPGAFPGSVAAPVAISRIVRGSRPKFIRSKGAVTISHRE
FT                   LVGQFNSSSGLVVNGGITGNLYRINPANAVLFPWLQTLASNFDQYVFNNLRLQYVPMCA
FT                   TTETGRVAIYFDKDSQDLEPVDRVELANMRHLTETAPWCEASLQVPVDRVKRFMNDNST
FT                   VDPKLIDLGQVGLATYGGPGTGVVGDLFIHYTVTFYEPQPSSGLIETDQSGTGSADAGP
FT                   VLVSVVGTATTTTLTFRSPGTYLVMMVQRALTFTGVTPIALTFNSNTNTTAAGTNYAAL
FT                   YNVTVPVPGAQMQFVGTGFGNYTLQVARAKITNVATLI"
XX
SQ   Sequence 1194 BP; 308 A; 284 C; 308 G; 294 T; 0 other;

AY500885  Length: 1194  February 22, 2005 08:35  Type: N  Check: 8125  ..

       1  aagattacac aatggcactt acgactacaa ataataatag agcaatggct
      51  cgagcagcga aacaagcatt acccgcgctg ggtgctttgg cgacatcagg
     101  agttggacag cagatgttca tgagcggtgt gaattatgca attgagaaag
     151  gcaagcaatt cgttaacaat cgcaggaaag ggaggaaaca atctgacatg
     201  gtgttgcacc ctggggcttt tccggggtct gttgcagcac cggtggcgat
     251  atctagaatc gtcaggggat cacgaccgaa atttataagg agcaaagggg
     301  ctgtcaccat ctcgcaccgt gagttggttg gccagttcaa tagctcctct
     351  gggttagtgg ttaacggggg aatcacaggg aatctctaca ggataaatcc
     401  ggctaatgcc gtactgttcc cttggttaca aacattagcg tcaaactttg
     451  accagtacgt gttcaacaat ctgaggctcc agtatgtacc tatgtgtgcc
     501  actactgaga ccggacgagt tgctatctac tttgacaagg actctcaaga
     551  ccttgaacct gtggatcgcg ttgaactagc taacatgcgg cacctcacag
     601  agacggcacc atggtgcgag gcctctctac aagtgcccgt ggacagggtg
     651  aaaaggttta tgaacgataa ttccaccgtt gaccctaagc ttatagattt
     701  aggtcaggtt gggctggcaa cttatggagg accgggaact ggtgtggtgg
     751  gagatctgtt catccactac acagttacct tctatgagcc acaaccatcc
     801  tcaggtctga tagaaactga tcaatctggt acaggctctg ctgacgcagg
     851  accagtactg gtgtctgtgg tgggcactgc aactaccacc acgttgactt
     901  tcagatctcc gggaacttac cttgtcatga tggtgcagcg ggcactcacc
     951  tttacaggtg ttacgcctat tgcgctcacg tttaattcca acaccaacac
    1001  taccgccgct ggaacgaact acgccgccct gtacaatgta actgtccccg
    1051  ttcctggggc acagatgcag tttgtcggca ctgggtttgg caattatact
    1101  ctacaagttg cacgagctaa gattaccaat gttgctacac ttatttagtc
    1151  ggtgagtgtc taggggcctc ttgaacaaga ccagttcatg gata