Sequence of DPV Sitke waterborne virus

Sikte waterborne virus isolate Lim 6 coat protein gene, complete cds.

ACC No: AY500886

Dated: 2005-02-14 | Length: 1194 | CRC: -1151535690

                !!NA_SEQUENCE 1.0
ID   AY500886   standard; genomic RNA; VRL; 1194 BP.
XX
AC   AY500886;
XX
SV   AY500886.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Sikte waterborne virus isolate Lim 6 coat protein gene, complete cds.
XX
KW   .
XX
OS   Sikte waterborne virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1194
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1194
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1194
FT                   /db_xref="taxon:255521"
FT                   /mol_type="genomic RNA"
FT                   /organism="Sikte waterborne virus"
FT                   /isolate="Lim 6"
FT   CDS             15. .1145
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS2"
FT                   /db_xref="UniProt/TrEMBL:Q64IS2"
FT                   /product="coat protein"
FT                   /protein_id="AAT00608.1"
FT                   /translation="MSMVRRNQNQAIMTAGAAAVAHYVGEVAFSPTGQKLIWDGVKFIA
FT                   SKLWNRRSKKGRGQDLVRHPGAQSGAIAAPVAVTRIIRASRPKFVRSKGSVTVTHRELI
FT                   SQIDTSAALSVNKGVTNLYRVNPTNSVLFPWLQTLATNFDQYTFERVRLQYVSLCGTTT
FT                   TGRVALYFDKDSQDDPPSNRIELANMAHLTETSPWAEASLNIPTDRIKRFTNDSATTDT
FT                   KLIDLGQIGVGTYGSTGVAAAGDLFIHYTVTLYEPQPSAGLVSTARLIGGETFTTRTGL
FT                   ITINGTSTAFGVNFNSPGTYLVIMQLKATAITDDATTSNTVVNSHFNTFSTGNSTSIRN
FT                   ITINEILSGIVVTGTGFGNHGVNVVRARPVNSVTFP"
XX
SQ   Sequence 1194 BP; 331 A; 276 C; 284 G; 303 T; 0 other;

AY500886  Length: 1194  February 22, 2005 08:35  Type: N  Check: 97  ..

       1  gagcaaacac aaacatgtcg atggtgagaa gaaatcagaa ccaggctatt
      51  atgacagcag gagcagccgc tgtagcccac tatgtgggtg aggtggcatt
     101  ttcccctact gggcagaagt taatttggga tggagttaaa tttattgcat
     151  ctaaactatg gaacaggaga agcaagaaag ggcgaggaca ggatcttgtg
     201  cgacatcctg gcgcgcagtc aggagccatt gcggcccctg tcgctgtcac
     251  caggattatc cgtgctagta ggcctaagtt cgtgcgaagt aaagggtcgg
     301  tgactgtaac tcatcgtgag cttatcagtc agatcgatac ctcagcagca
     351  ttatctgtta ataagggagt taccaactta tacagagtta acccaactaa
     401  ttcggtactc ttcccttggc tacaaacgtt agcaaccaac tttgatcagt
     451  acacttttga gagagtgcgt ctacagtatg tgtccttgtg cggaacgaca
     501  actacaggcc gggtagctct gtattttgac aaagattcac aggatgaccc
     551  acctagtaat aggattgagc tggctaatat ggcccatcta accgaaacta
     601  gtccatgggc ggaggcatct ctcaatatac ctacagatag gatcaaacgg
     651  ttcactaatg atagtgctac tacagacacg aagctcatcg atcttgggca
     701  gattggcgtg ggtacatatg gatccacagg tgtggctgcg gctggtgatt
     751  tgtttataca ctatacagtg acactctatg aaccacagcc ttcagccggt
     801  cttgtatcga ccgcacgcct tattggtgga gaaactttca ctactaggac
     851  agggttgatt accatcaatg gaacatcaac cgcctttggt gtcaatttca
     901  attcccctgg tacttacctg gttatcatgc agttgaaggc aacagccatc
     951  acagacgatg caacgacatc caacacagtt gtcaactccc actttaacac
    1001  attcagtacc ggtaactcca cgtctatccg caacattact attaatgaga
    1051  tcctctcggg aatagttgtt actggtacag gatttgggaa tcacggtgtg
    1101  aatgttgtca gggctaggcc ggtaaactcg gtcacattcc cttaaccatc
    1151  aggcatgcaa taggggcctc ttgaatctaa ccaattcatg gata