Sequence of DPV Grapevine Algerian latent virus

Grapevine Algerian latent virus isolate SchunterRiver coat protein gene, complete cds.

ACC No: AY500888

Dated: 2005-02-14 | Length: 1196 | CRC: -1896992454

                !!NA_SEQUENCE 1.0
ID   AY500888   standard; genomic RNA; VRL; 1196 BP.
XX
AC   AY500888;
XX
SV   AY500888.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 3)
XX
DE   Grapevine Algerian latent virus isolate SchunterRiver coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine Algerian latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1196
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1196
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1196
FT                   /db_xref="taxon:208084"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine Algerian latent virus"
FT                   /isolate="SchunterRiver"
FT   CDS             12. .1148
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS0"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/TrEMBL:Q64IS0"
FT                   /product="coat protein"
FT                   /protein_id="AAT00610.2"
FT                   /translation="MALALNTRRNNNGKVMEMLAYKAATAGAELALANVGTITRGVAQL
FT                   GKNMLGKRKRNKQLVSQVGALGGAIVAPVAVTRQIRGSKPKFSGRGTGSITVTHREYLG
FT                   QVATTADLQVNGGITGNLLKVNPLNGILFSWLPTIAAGYDQYAFNRLSLQYVPLCATTA
FT                   TGRVAMYWDKDSTDPEPTDRVELANQAILKETSPWAEANLTIPTDRIKRFCDDSAVADR
FT                   KLVDLGQFGVATYGTGSVMVAGDVFVSYTVTFYNPQPLATLMDTTRINTSNAVITNVGP
FT                   QYTRIDIVSGNQWLITFRGVGKFVIFGSIRGTGAVALATSGVIVNSSTTLATATGAMYV
FT                   ANVTVSSLPASVSYTMTTVTAGLHSAVRATRANDMTTP"
XX
SQ   Sequence 1196 BP; 312 A; 289 C; 312 G; 283 T; 0 other;

AY500888  Length: 1196  February 22, 2005 08:35  Type: N  Check: 8074  ..

       1  aagtaaacac aatggcatta gcactaaaca cacgaagaaa caacaacgga
      51  aaggtgatgg agatgttggc atataaggca gccacggctg gcgctgaatt
     101  ggctttggcc aatgtgggca ccataacccg tggtgtggca cagctaggta
     151  aaaatatgct cggcaagaga aagaggaata agcaactcgt atcccaggtg
     201  ggtgcgttag gtggggctat cgttgccccc gtggctgtta ccagacaaat
     251  acgtgggtct aagcccaagt tctccggcag agggactggt agcattacgg
     301  ttacacatag agaatacttg ggccaggtag ctacgacggc tgacctacaa
     351  gttaacggtg gcattacagg caacctgctg aaagttaacc cattgaatgg
     401  catacttttc tcctggttac caacaattgc cgctggttat gaccagtatg
     451  cctttaatag gctatcgcta cagtatgtac ccttgtgtgc tactacggca
     501  actggtcgtg ttgcgatgta ttgggataag gactctacgg atcctgaacc
     551  cactgatcgt gttgagctgg ccaaccaagc aatcttgaag gaaacgtcgc
     601  catgggctga agcaaatttg actataccca ccgatcgcat caagagattc
     651  tgcgatgata gtgcagtcgc tgaccgcaaa ctcgtggatc tcggacagtt
     701  tggagtggct acatatggta ctggctcggt gatggttgcc ggggatgtgt
     751  tcgtcagtta cacggtcacg ttctataacc cacagccact ggccacctta
     801  atggacacca cgcggattaa tacctctaat gccgtcatta ctaatgtggg
     851  accgcagtat acacgaatag acattgtctc aggcaatcaa tggctgatca
     901  cctttcgggg tgttggcaag tttgtcatat ttggtagtat acgcggcact
     951  ggggcagttg cacttgccac cagtggagta atcgtcaact cgtccactac
    1001  cttggctacg gccacaggag cgatgtatgt cgccaacgtc accgtatcat
    1051  cactaccggc aagtgtatca tacaccatga ccacggttac agctgggtta
    1101  cactcagctg ttcgtgccac cagggccaat gatatgacca caccttagtg
    1151  cgtgcctact gaaggggcct cttgaacaaa gaccagttca tggata