Sequence of DPV Sitke waterborne virus

Sikte waterborne virus isolate Eckbach coat protein gene, complete cds.

ACC No: AY500889

Dated: 2005-02-14 | Length: 1194 | CRC: -778020184

                !!NA_SEQUENCE 1.0
ID   AY500889   standard; genomic RNA; VRL; 1194 BP.
XX
AC   AY500889;
XX
SV   AY500889.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Sikte waterborne virus isolate Eckbach coat protein gene, complete cds.
XX
KW   .
XX
OS   Sikte waterborne virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1194
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1194
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1194
FT                   /db_xref="taxon:255521"
FT                   /mol_type="genomic RNA"
FT                   /organism="Sikte waterborne virus"
FT                   /isolate="Eckbach"
FT   CDS             15. .1145
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IR9"
FT                   /db_xref="UniProt/TrEMBL:Q64IR9"
FT                   /product="coat protein"
FT                   /protein_id="AAT00611.1"
FT                   /translation="MSMVRRNQNQAIMAAGAAAVAHYVGEVAFSPTGQKLIWDGVRFIA
FT                   SKLWNRRSKKGRGQDLVRHPGAQSGAIAAPVAVTRIIRASRPKFVRSKGSVTVTHRELI
FT                   SQIDTSAALSVNKGVTNLYRVNPSNSVLFPWLQTLATNFDQYTFERVRLQYVPLCGTTT
FT                   TGRVALYFDKDSQDDPPSNRIELANMAHLTETSPWAEASLNIPTDRIKRFTNDSATTDT
FT                   KLIDLGQIGVGTYGSTGVAAAGDLFIHYTVTFYEPQPSAGLVSTVRLINGESFTTRTGL
FT                   ITISETSTAFGVSFNSPGTYLIIIQLKATTITDDATSSNTVVNSHFNTFSTSNFTSIRN
FT                   ITINEILSGIVVTGTGFGNHSVNVVRARPINSVTFP"
XX
SQ   Sequence 1194 BP; 338 A; 273 C; 275 G; 308 T; 0 other;

AY500889  Length: 1194  February 22, 2005 08:35  Type: N  Check: 2716  ..

       1  aagcaaacac aaacatgtcg atggtaagaa gaaatcagaa tcaagctatt
      51  atggcagcag gagcagccgc tgttgcccac tatgtgggtg aggtggcatt
     101  ttcccctact gggcagaagt taatttggga tggagtcaga tttattgcat
     151  ctaaactatg gaacaggaga agtaagaaag ggcgaggaca ggatcttgtg
     201  cgacatcctg gtgcgcagtc aggagccatt gcggcccctg tcgctgtcac
     251  caggattatc cgtgctagta ggcctaagtt cgtgcgaagt aaagggtcgg
     301  tgactgtaac tcatcgtgag ctcatcagtc agatcgatac ctcagcagca
     351  ttatctgtta ataagggagt taccaactta tatagagtta acccatctaa
     401  ttcggtactc ttcccttggt tacaaacgtt agcaaccaac tttgatcagt
     451  acacttttga gagagtgcgt ctacaatatg tacccttgtg cggaacgaca
     501  actacaggcc gggtagcctt gtattttgac aaagattcac aagatgaccc
     551  acctagtaat aggattgagc tggctaatat ggcccatcta accgaaacta
     601  gtccatgggc ggaagcatct ctcaatatac ctacagatag gatcaaacgg
     651  ttcactaatg atagtgctac tacagacacg aagctcatcg atcttgggca
     701  gattggcgtg ggtacatatg gatccacagg tgtggctgcg gcaggtgatt
     751  tgttcataca ctacacggtg acattctatg aaccacagcc gtcagccggt
     801  cttgtatcga ccgtacgcct tattaatgga gaatctttca ccactaggac
     851  ggggttgatc actatcagtg aaacatcaac cgcctttggt gtcagtttca
     901  attctcctgg tacctacctg attatcatac aattgaaagc aacaactatc
     951  acagacgatg caacgtcatc caacacagtt gtcaactccc actttaacac
    1001  attcagcacc agtaacttca cgtctatccg taacattact attaatgaga
    1051  tcctctcggg aatagttgtc acgggcacag gatttgggaa tcacagtgtg
    1101  aatgttgtca gggctaggcc gataaactcg gtcacatttc cttaaccatc
    1151  aggcatgtgt taggggcctc ttgaatctaa ccaattcatg gata