Sequence of DPV Eggplant mottled crinkle virus

Eggplant mottled crinkle virus coat protein gene, complete cds.

ACC No: AY500890

Dated: 2005-06-10 | Length: 1228 | CRC: 1732004216

                !!NA_SEQUENCE 1.0
ID   AY500890   standard; genomic RNA; VRL; 1228 BP.
XX
AC   AY500890;
XX
SV   AY500890.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   10-JUN-2005 (Rel. 84, Last updated, Version 3)
XX
DE   Eggplant mottled crinkle virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Eggplant mottled crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1228
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1228
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1228
FT                   /db_xref="taxon:270256"
FT                   /mol_type="genomic RNA"
FT                   /organism="Eggplant mottled crinkle virus"
FT   CDS             24. .1190
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IR8"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q64IR8"
FT                   /product="coat protein"
FT                   /protein_id="AAT00612.1"
FT                   /translation="MEIVRRNNNSAIAINKKQLATMAATAAAGALSNYVKNNGAMIVQG
FT                   AVNMGKKAYGAVRNRKNKGNSQAMVHVGGMGGAMMAPVAVSRQLVGSKPKFAGRTAGSV
FT                   TVTHREYLTQVNNSSAFTTNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYVFNSVVLH
FT                   YVPLCGTNEVGRVAMYWDKDSEDPEPADRVELANFGILKETAPWAEAILRVPTDKMKRY
FT                   CDDSTVVDRKLIDLGQLGISTYGGTGTNPVGDVFVSYSVTLYFPQPTNTLLSTRQLSLT
FT                   GALEASTGPGYINVTRTPTLLTITFRSTGTFLLSGVFRDTGVAVLGVTGGIGINSQTTL
FT                   DVVGVATSFLVNCTVSTLPATLTYGSAGITSVTANCTRATRANTATLL"
XX
SQ   Sequence 1228 BP; 330 A; 283 C; 318 G; 297 T; 0 other;

 AY500890  Length: 1228  June 21, 2005 08:54  Type: N  Check: 8464  ..

       1  aagtgaacac aagcgacata gcaatggaaa tcgttaggag aaacaataat
      51  agtgcaatcg caatcaacaa gaaacaactg gccactatgg cggctactgc
     101  cgccgctggg gctctgagca attatgtgaa gaacaatgga gcaatgatcg
     151  tacaaggtgc ggtgaatatg ggcaagaagg cttatggagc agtaaggaat
     201  cgtaagaata agggtaattc acaggcaatg gtgcacgtag gtggtatggg
     251  cggggctatg atggcccctg tggcagtatc ccggcaactt gtgggcagta
     301  agccaaagtt cgcaggtagg actgctggat cagtcacagt cacccaccgt
     351  gagtacttaa cccaggtgaa caactcctct gcttttacaa ccaatggagg
     401  gattgtcggg aatttgttac aactcaaccc gcttaatggc acactgtttt
     451  cgtggttacc ggctatcgcg tcgaacttcg atcagtacgt ctttaacagc
     501  gttgtgttac attatgtccc cctctgtggc acaaatgaag tagggcgtgt
     551  tgcaatgtac tgggataagg actctgagga tcctgagcct gcggatagag
     601  tggaattagc taatttcggt atacttaaag agacggcccc atgggccgaa
     651  gctattttga gggtcccaac tgataagatg aaacgatact gcgatgacag
     701  tacagtggtt gacaggaagc ttatcgacct cggacagctc ggaatatcta
     751  catatggagg aaccggaact aatcctgtgg gggatgtgtt tgtgtcgtat
     801  agcgttacgc tttacttccc acaacccacg aataccctac tcagcacgcg
     851  acagcttagc cttactggcg ccctagaagc atctactggg cctggatata
     901  ttaacgtaac acgtacacca acactcttga ctataacatt caggtctacc
     951  ggaactttcc tgctttcggg agttttccgg gacactggtg ttgctgttct
    1001  tggtgtgacg gggggcatag gaattaatag tcaaaccaca cttgatgttg
    1051  ttggcgtagc cacatcattt cttgtgaact gtacagtgtc cacactaccc
    1101  gctacactca catatggatc tgctgggata acatctgtca ctgcgaattg
    1151  cacacgggcc acaagggcca acaccgcaac attgctatag tcgcctcggg
    1201  gcctcttgaa cagaccagtt catggata