Sequence of DPV Tobacco necrosis virus A

Tobacco necrosis virus A, complete genome.

ACC No: AY546104

Dated: 2008-02-27 | Length: 3682 | CRC: -1983053277

                
ID   AY546104; SV 1; linear; genomic RNA; STD; VRL; 3682 BP.
XX
AC   AY546104;
XX
DT   02-MAR-2005 (Rel. 83, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 3)
XX
DE   Tobacco necrosis virus A, complete genome.
XX
KW   .
XX
OS   Tobacco necrosis virus A
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3682
RX   PUBMED; 18071890.
RA   Xi D., Li J., Han C., Li D., Yu J., Zhou X.;
RT   "Complete nucleotide sequence of a new strain of Tobacco necrosis virus A
RT   infecting soybean in China and infectivity of its full-length cDNA clone";
RL   Virus Genes 36(1):259-266(2008).
XX
RN   [2]
RP   1-3682
RA   Xi D., Li D., Zhou X., Yu J., Yuan X., Cao Y., Li J.;
RT   "Functional analysis of tobacco necrosis virus strain A-C";
RL   Unpublished.
XX
RN   [3]
RP   1-3682
RA   Xi D., Li D., Zhou X., Yu J., Yuan X., Cao Y., Li J.;
RT   ;
RL   Submitted (11-FEB-2004) to the EMBL/GenBank/DDBJ databases.
RL   State Key Laboratory of Agrobiotechnology, China Agricultural University,
RL   #2 Yuanmingyuan West Rd., Beijing, Beijing 100094, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3682
FT                   /organism="Tobacco necrosis virus A"
FT                   /strain="A"
FT                   /isolate="Tobacco necrosis virus A-C"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12055"
FT   5'UTR           1. .59
FT   gene            60. .2234
FT                   /gene="RdRp"
FT   CDS             60. .2234
FT                   /codon_start=1
FT                   /transl_except=(pos:666. .668,aa:OTHER)
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="putative readthrough stop codon"
FT                   /db_xref="GOA:Q5DQE6"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DQE6"
FT                   /protein_id="AAT69238.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQADLALI
FT                   EDTEHLDDINECFEESAGAQSQRTKVVAEGAYAPAKSNRTRRVRKQKKHKFVKYLVNEA
FT                   RAEFGLPKPTEANRLMVQHFLLRVCKDWGVVTAHVHGNVALALPLVFIPTEDDLLSRAL
FT                   MNTYATRAAVRGMEHTQGEGWWNNRLGIGGQVGLAFRSKXGCLERRPGFSTSVSRGEHP
FT                   DLVVIPSGRPEKQRQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFYVEGPSGLQDAP
FT                   KPVKGAFRTLDKFRDLYTKNSWRHTPVTSEQFLMNYSGRKLTIYREAVDSLSHQPLSSR
FT                   DAKLKTFVKAEKLNLSKKPDPAPRVIQPRSPRYNVCLGRYLRHYEHHALKTIAKCFGEI
FT                   TVFKGFTLEQQGEIMRSKWNKYVNPVAVGLDASRFDQHVSVEALEYEHEFYLRDYPNDK
FT                   QLKWLLKQQLCNIGTAFASDGIIKYKKEGCRMSGDMNTSLGNCILMCAMVYGLKEHLGI
FT                   KLSLANNGDDCVIVCEKADLSKLTSSIEPYFKQFGFKMEVEKPVDIFERIEFCQTQPVF
FT                   DGNQYIMVRKPSVVTSKDVTSLIPCQNQAQYAEWLQAVGECGMSINGGIPVMQNFYQML
FT                   QTGVSRTKFTKTGEFQANGLGYHSRFMNRVARSPSPETRLSFYLAFGITPDLQEALEIF
FT                   YDTTKLELDDVVPTDTYQVSGEHLINGLSN"
FT   gene            2218. .2436
FT                   /gene="P7"
FT   CDS             2218. .2436
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="P7"
FT                   /note="possibly related to cell-to-cell movement of the
FT                   virus"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DQE5"
FT                   /protein_id="AAT69239.1"
FT                   /translation="MDYQTDVSEDNVQVRGRARSSEGKKHNGSGLTGVKRHAVSETSQK
FT                   SQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   gene            2439. .2609
FT                   /gene="P5"
FT   CDS             2439. .2609
FT                   /codon_start=1
FT                   /gene="P5"
FT                   /product="P5"
FT                   /note="possibly related to cell-to-cell movement of the
FT                   virus"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DQE4"
FT                   /protein_id="AAT69240.1"
FT                   /translation="MAYCRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   gene            2612. .3442
FT                   /gene="CP"
FT   CDS             2612. .3442
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q5DQE3"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DQE3"
FT                   /protein_id="AAT69241.1"
FT                   /translation="MAGKKNNNNGQYIVLRTPEQQVEIDQRDARRLARGRMKKMRQPVQ
FT                   RYINEHGLQNGLSGRGGYVVAPASGGVVTRPIVPKFSNRGDSTIVRNTEILNNQILAAA
FT                   GAFNTTNSALIAAAPSWLAGISDLYSKYRWLSCELIYIPKCPTTTSGSVAMAFTYDRND
FT                   AAPTTRAQLSQSYKAINFPPYAGYDGAAYLNSMRGAGTAIAIQLDITKLDKPWYPTISS
FT                   GAFAALGVLDQNQFCPASVVVASDGGPVAATPAGDIFIKYVIEFIEPINPTMNV"
FT   3'UTR           3443. .3682
XX
SQ   Sequence 3682 BP; 1013 A; 864 C; 924 G; 881 T; 0 other;

ay546104 Length: 3682  27-FEB-2008  Type: N  Check: 2190  ..

       1  agtattcata ccaagaatac cggataggtg cgaagcctta ctcagccaaa
      51  gagtctaaaa tggagttacc aaaccaacac aagcaaacag ccgccgaggg
     101  ttttgtttct ttcctaaact ggctatgcaa tccatggcgc cgacaacgta
     151  cagtcaacgc tgccgttgcg ttccaagccg acctggccct cattgaggac
     201  acagagcatc ttgatgacat caatgagtgc tttgaggagt cggctggggc
     251  tcaatcgcag cgcactaagg ttgtggcaga aggagcatat gcgcccgcta
     301  aatccaatag aacccgccgg gtccgtaagc agaaaaagca caagttcgtt
     351  aaatatcttg tgaacgaggc ccgagccgag tttgggttgc ctaaaccaac
     401  tgaggcaaac agactcatgg ttcaacattt cctgctcagg gtgtgtaagg
     451  attggggtgt ggtcacagcc cacgtacacg gcaacgttgc acttgcattg
     501  cctctggtgt ttattccaac ggaagacgat ctgctgtcaa gagcattgat
     551  gaacacgtac gctacaaggg ccgctgtacg gggcatggag cacacccagg
     601  gagaggggtg gtggaacaat aggttgggga ttggaggcca ggttggactg
     651  gccttccggt ccaaataggg gtgccttgaa aggaggccag gattctccac
     701  gtccgtttcg cgtggggaac atcctgatct ggtggtcata ccatcagggc
     751  gccctgagaa acagcgtcag ttgttacgct atagtggtat aggcggccat
     801  ttattaatcg gcatccacaa caactctctt tccaacttac gtaggggttt
     851  gatggaaaga gtattttacg tcgaggggcc ttcgggtctc caagatgccc
     901  ctaagcccgt caagggagcg ttccgaaccc ttgataagtt ccgcgatctc
     951  tataccaaaa atagttggcg tcatacccct gtaactagtg agcaattcct
    1001  aatgaattac tcgggcagga aactaactat ttaccgagaa gcagttgata
    1051  gtttgtcgca tcaaccgctt agctccagag atgcgaagtt gaagacattc
    1101  gttaaggccg aaaaacttaa tctttctaag aagcctgacc ctgcccccag
    1151  ggtcatccaa cctagatcgc ctcggtacaa cgtttgtttg ggcaggtacc
    1201  tccgacatta tgaacatcat gcgctcaaaa ccattgctaa atgctttggg
    1251  gaaatcacgg tcttcaaggg gtttactctc gagcaacaag gtgaaatcat
    1301  gcggtccaag tggaataaat atgttaatcc cgtcgcggtc ggactcgatg
    1351  ccagtcggtt tgaccaacac gtgtctgttg aagcacttga gtacgagcat
    1401  gaattttatt tgagagatta ccctaatgat aaacagctga aatggttgct
    1451  aaagcaacaa ctgtgcaaca taggcacggc atttgctagt gatggcatca
    1501  taaagtacaa gaaggaaggt tgcagaatga gtggggacat gaacactagt
    1551  ttgggcaatt gcatactcat gtgcgcaatg gtctacggtc ttaaagaaca
    1601  cctaggaatc aaattgtcgt tggcaaacaa cggggatgac tgcgtcattg
    1651  tctgtgagaa agcggattta tcaaagttga cgagcagcat cgaaccgtat
    1701  ttcaagcaat ttggattcaa aatggaggtg gagaaacccg tggacatatt
    1751  cgagagaatt gaattttgcc aaacccagcc tgtgttcgat ggtaaccagt
    1801  acataatggt gcgaaagcct tccgttgtaa cttccaaaga tgtcactagt
    1851  ctaataccct gtcaaaacca ggcacaatat gcagaatggc tgcaagctgt
    1901  aggtgagtgt ggcatgagca tcaatggtgg aatccctgtt atgcagaatt
    1951  tctaccaaat gcttcaaact ggcgtaagcc gcacaaaatt caccaagacc
    2001  ggcgagttcc aggcgaatgg cttggggtat cactctagat tcatgaatag
    2051  agtggcccgg agtccttcgc ccgaaacccg tttgtccttt tacctagctt
    2101  ttggtatcac accagacctc caggaagcac tggagatctt ctatgatacc
    2151  acgaagctgg agctggacga tgttgtccca actgatacat accaagtatc
    2201  aggagagcat ttgatcaatg gattatcaaa ctgatgtcag tgaggacaat
    2251  gtgcaagttc gcggtcgggc taggagtagt gagggtaaga aacacaatgg
    2301  ttcgggattg actggcgtaa agcgtcacgc ggtgagtgaa acatctcaga
    2351  aatcacagca aggtactggc aacggaacaa tgaccaacat agccgaagag
    2401  cagaccatta ccgtgacata caactttaac ttttagttat ggcgtattgt
    2451  cgctgttgtg atacttcacc aggtattaca ttattcccct actttgcaat
    2501  tctcatcctc atattagcaa tacttgttgt tggcactcca aaccaacaat
    2551  atcatcattc tcctagtact tacgagtata agactcaaca catttcgatc
    2601  gcaaaataga catggcagga aagaagaaca acaacaatgg tcagtacatt
    2651  gtactgcgta ctccagagca acaggtggaa attgaccagc gtgatgcacg
    2701  caggctggca cgaggccgca tgaagaaaat gaggcagcca gttcagcgct
    2751  acatcaacga gcatgggcta caaaatgggt tgtcagggcg aggtggttac
    2801  gtcgtcgctc ccgcatctgg tggggtggtg actcgaccca tcgtaccaaa
    2851  gttttctaac agaggtgact cgactattgt tcgcaatacc gagatcctaa
    2901  acaaccaaat attagccgca gctggcgcgt tcaacactac caattccgca
    2951  ctgattgcag cggcaccatc atggttggct ggaatttctg atttatacag
    3001  taaatataga tggctttctt gtgagctcat ctacatacct aaatgtccaa
    3051  ccacaacaag tggatctgtt gcaatggctt tcacttatga tcgtaatgat
    3101  gctgccccta ccacaagggc gcagttatca caatcttaca aagccatcaa
    3151  ttttccaccc tacgcagggt atgacggagc agcgtacttg aactcaatga
    3201  gaggtgctgg gacagccatt gctatccagt tggatatcac caagctggac
    3251  aagccttggt accctaccat ctcttcaggt gcctttgctg cccttggtgt
    3301  gctggaccag aatcaattct gcccggcatc cgtagttgtc gctagtgatg
    3351  ggggtcctgt agcagccaca cctgctgggg acatcttcat caagtacgtg
    3401  attgagttca ttgaaccaat caacccaaca atgaacgtgt agttcttgta
    3451  ctgtaactcg accaatgcct acggcagagt cacacgtgtg gagatggatg
    3501  ctggatcctg agaaacaggt ttaacgggta gggggtggtg cccctaccga
    3551  cgcatcactc cagataccac acgtactcgg ctatggcagg gtctgtcgag
    3601  gtatgtgcgc caagaaccac tggaaacggt ggtgaggggg gtagcacaat
    3651  tcatccagat tgaggggctt ttgccccacc cc