Sequence of DPV Thielaviopsis mitovirus 1

Thielaviopsis basicola mitovirus RNA-dependent RNA polymerase gene, complete cds.

ACC No: AY563138

Dated: 2009-04-22 | Length: 2896 | CRC: -1361081893

                
ID   AY563138; SV 1; linear; genomic RNA; STD; VRL; 2896 BP.
XX
AC   AY563138;
XX
DT   10-MAY-2004 (Rel. 79, Created)
DT   22-APR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Thielaviopsis basicola mitovirus RNA-dependent RNA polymerase gene,
DE   complete cds.
XX
KW   .
XX
OS   Thielaviopsis basicola mitovirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus; unclassified Mitovirus.
XX
RN   [1]
RP   1-2896
RX   PUBMED; 18944306.
RA   Park Y., Chen X., Punja Z.K.;
RT   "Molecular and Biological Characterization of a Mitovirus in Chalara
RT   elegans (Thielaviopsis basicola)";
RL   Phytopathology 96(5):468-479(2006).
XX
RN   [2]
RP   1-2896
RA   Park Y., Punja Z.K.;
RT   ;
RL   Submitted (02-MAR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biology, Simon Fraser University, 8888 University Drive, Burnaby, BC V5A
RL   1S6, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2896
FT                   /organism="Thielaviopsis basicola mitovirus"
FT                   /host="Thielaviopsis basicola strain BK18"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:274584"
FT   CDS             427. .2544
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /product="RNA-dependent RNA polymerase"
FT                   /db_xref="GOA:Q6Q2W5"
FT                   /db_xref="InterPro:IPR008686"
FT                   /db_xref="UniProtKB/TrEMBL:Q6Q2W5"
FT                   /protein_id="AAT09164.1"
FT                   /translation="MIKYMKSVRLHITRYICRKPLFINDSGVSVDKSGFPTKFIELKKF
FT                   LNNHESSICYHTRLRIILTLLLLPRGLKPTKIEDAKIKPNFSSITLPFSGTRMNPIPTW
FT                   FIKEFVKEYNLKLEKPTYDLSKHYLSPKGGPMGKSTWSSIWSMYALKHELHLSLSYFLG
FT                   EAYKTLFYLPYLKNMALSYGHDVPPKQWPSGKLGIVKDPEGKRRIIAMVDYHSQLVLRS
FT                   IHDGLLNKLRNLPQDRTYNQDPNNAWEENKECFHSLDLSSATDRFPVKLQSRLLTEMYS
FT                   DPSFGENWMNLLLNRDYLLPEEGLSGERLRYAVGQPMGAYSSWAAFTLSHHLVVAWCTY
FT                   KSKKVIRSSQYIILGDDIVIKDNDIARKYIGQMSKLGVAISMQKTHVSKDTYEFAKRWM
FT                   HKGVEISGLPLKGIFYNISHMRRMYTIIFDYLQRIPSKSNLTSLQLFASCLSGIKFGKR
FT                   VYSKALILKLLRNFNISLRYSYGLLTPYELREYILTGFNMGDEVLPSDNRILEWFKGII
FT                   CDGVAGKVSTLSREYTKEVNSLEEHRSSQHILNSINIEITYENLQWSPLIIGMFNHINK
FT                   VSEKCGEWLYGDVPLMDIIQQFTLPSADSLSRKDRDINKKIDELDSLIFKSIKRHFSDQ
FT                   PYPDHFYGTRSNGDKNLYPGLGALDVNVAPEIGFEIKSPINFILKTEIQRLHGNLEMQM
FT                   EKPLREAGIKC"
XX
SQ   Sequence 2896 BP; 1015 A; 455 C; 488 G; 938 T; 0 other;

ay563138 Length: 2896  22-APR-2009  Type: N  Check: 1432  ..

       1  ccgttctccc cttttgggga gaggcggcta tttcttatat agttataact
      51  atataccaaa tagaaacaag actcgaaaga gcagattgga cctaattaag
     101  gtatcccagt ctagtcactg gttatgactc aaataacaaa ctacatagtt
     151  ttgtaccagg gcctgataag ctttgtgtaa catctatgcc gtgaataaca
     201  gaaacaaaat atttcaatta ttacaacaaa ctttaacaac aatttattaa
     251  agcttaaagc taacatttta aacaaaagtt taaaattcca aggaggggtc
     301  tcccccttac ttgttaaatt aactataaac cttataataa atatatttgg
     351  aaaagttgat tatagaatta ttaagaattt tctatctgag ataaccaaat
     401  tatgaagaaa taatggtttc ttatatatga ttaagtatat gaaatctgtt
     451  agattacata taactcgata catatgtaga aaaccgttat ttattaatga
     501  ttcaggtgtt tcagtagata aaagtggatt tccaactaag tttatagaac
     551  ttaagaaatt tttaaataac catgaaagta gtatttgtta tcatactaga
     601  ttacgtataa ttttaacatt attgcttcta cctcgtggat taaaacccac
     651  aaagatagaa gatgctaaaa ttaaacctaa ttttagttcg ataactttac
     701  cattttcagg gactagaatg aatcctattc ccacttggtt tattaaagaa
     751  tttgttaagg agtataacct taaattggag aaaccaacct atgacctaag
     801  taaacattac ttaagtccaa agggaggtcc gatgggaaaa tctacatgat
     851  catcaatatg atcaatgtat gctcttaaac acgagcttca tttatcacta
     901  tcatatttct taggtgaggc atataaaaca ttgttttatc ttccttatct
     951  gaaaaatatg gcattgtctt atgggcacga tgtgccccca aaacaatggc
    1001  ctagtggtaa attaggtatt gttaaagatc cggaaggtaa aagaagaata
    1051  attgcaatgg tagattacca ttcacaatta gttcttcgtt caatccatga
    1101  tgggcttctt aataaattaa gaaacctacc acaggataga acatacaatc
    1151  aagatcctaa caatgcgtga gaagagaata aggaatgttt ccattcctta
    1201  gatttatcat cagccactga tagattccca gtaaaactgc aatctagact
    1251  gcttacagag atgtattcag atcctagttt tggagagaac tgaatgaatc
    1301  tgctcttaaa tagagattat ctattgccag aagaaggcct atcgggtgaa
    1351  agattgcgtt atgcagtcgg tcaaccgatg ggtgcttatt ctagttgagc
    1401  agcattcaca ctttctcacc acttagtagt tgcctgatgt acttataagt
    1451  caaagaaggt cataagatct tctcaatata ttatacttgg tgatgatatt
    1501  gtcattaaag acaatgacat cgcaagaaag tatattggac aaatgagtaa
    1551  attaggtgtt gctatttcaa tgcaaaagac acatgtatcg aaagatacat
    1601  atgaatttgc aaagagatga atgcataaag gagtggagat atcaggatta
    1651  cccttgaaag gtatctttta taatatatct catatgcgtc gtatgtatac
    1701  gatcatattt gattatttac aaaggatccc ttccaagtct aatttgactt
    1751  ctctgcaact tttcgcatct tgtttaagtg gtattaaatt cggtaaaaga
    1801  gtatattcta aagcgttaat acttaagtta ctacgtaact ttaatatttc
    1851  gctccgttac tcatatggat tgttaactcc atatgaatta cgtgaatata
    1901  ttcttacagg atttaatatg ggagatgaag ttcttccatc agataataga
    1951  atccttgaat gattcaaggg tattatatgt gatggagttg ctggaaaagt
    2001  ctcaaccctt tctcgtgagt acactaagga ggtgaacagt ttagaagagc
    2051  atagatcatc tcaacatata ttgaattcaa taaatattga aataacttat
    2101  gaaaatctac aatgatcacc acttatcata ggtatgttta atcatattaa
    2151  taaagtatct gagaagtgtg gagaatgatt gtatggtgac gttccattaa
    2201  tggacattat ccaacaattt actctacctt cagcagattc tttatcaaga
    2251  aaagaccgag atataaataa aaagattgat gaattagatt cactaatctt
    2301  taaatctatc aaacggcatt ttagtgatca accataccca gatcacttct
    2351  atggtacaag gtccaatgga gataaaaatt tatatcctgg acttggtgcc
    2401  ttagacgtga atgtagctcc cgagattggc tttgaaatta aaagcccgat
    2451  taattttatc cttaaaactg aaattcaaag attacatggt aatcttgaaa
    2501  tgcagatgga aaaacctctt cgggaagctg gaattaaatg ttagaacatg
    2551  gagtagttac catgtctacc gctttaatcc agattatttt aatggaagag
    2601  tatggaatag ttaccatacc tcccgcttaa aatacaaata gttcaaagtg
    2651  agactatata taataatatt gctataaaca actgttaatt aaagtgctgg
    2701  gtttatccat acttttagct ttattttaac agatgaagtt gaagtgctgg
    2751  gtttacccat acctttagct taacttaaca tccaaattta tttgttatcg
    2801  ttataactta gttaccaagt tgtgattaac atgttcacaa cttgtcttaa
    2851  ggttatagcg ccgtaattct ctgaacttaa aagttcagag gaacgg