Sequence of DPV Infectious myonecrosis virus

Penaeid shrimp infectious myonecrosis virus, complete genome.

ACC No: AY570982

Dated: 2013-03-10 | Length: 7561 | CRC: -1647299140

                
ID   AY570982; SV 2; linear; genomic RNA; STD; VRL; 7561 BP.
XX
AC   AY570982;
XX
DT   14-MAR-2006 (Rel. 87, Created)
DT   10-MAR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Penaeid shrimp infectious myonecrosis virus, complete genome.
XX
KW   .
XX
OS   Penaeid shrimp infectious myonecrosis virus
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-7561
RX   PUBMED; 16528049.
RA   Poulos B.T., Tang K.F., Pantoja C.R., Bonami J.R., Lightner D.V.;
RT   "Purification and characterization of infectious myonecrosis virus of
RT   penaeid shrimp";
RL   J. Gen. Virol. 87(PT 4):987-996(2006).
XX
RN   [2]
RP   1-7561
RA   Tang K.F.J., Poulos B.T., Pantoja C.R., Bonami J.R., Lightner D.V.;
RT   ;
RL   Submitted (10-MAR-2004) to the INSDC.
RL   Veterinary Science & Microbiology, The University of Arizona, 1117 E.
RL   Lowell St., Tucson, AZ 85721, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-7561
RA   Tang K.F.J., Poulos B.T., Pantoja C.R., Bonami J.R., Lightner D.V.;
RT   ;
RL   Submitted (08-MAR-2013) to the INSDC.
RL   Veterinary Science & Microbiology, The University of Arizona, 1117 E.
RL   Lowell St., Tucson, AZ 85721, USA
XX
CC   On Mar 8, 2013 this sequence version replaced gi:51921552.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7561
FT                   /organism="Penaeid shrimp infectious myonecrosis virus"
FT                   /host="Penaeus vannamei"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /db_xref="taxon:282786"
FT   CDS             2227. .4953
FT                   /codon_start=1
FT                   /product="structural protein"
FT                   /note="coat protein; ORF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q24M82"
FT                   /protein_id="AAT67230.1"
FT                   /translation="MHVENGNIVSMENQSEIDSQTKFFSLLEDDNKLPIVDELRVLADM
FT                   TAQRSNVNTAGNHLRDNDSIRADAVLANNTVRNNCQIPIPVTTLIPRQIRGLNGVLVNQ
FT                   QLRLQGIETHITDSYISKAEPSDYSKQLSEMVNAQKTSTWRANNIASQGWDMFDTVQLN
FT                   TNISQKDLSMDTALTKLMLLYQLTTQNLPATQLPSSIYSAFDSRTQPTLQDGIWGINNG
FT                   VNIFGEQCGGLAAPVFPFSGGTGEITFHLTLQSVPQEFQESAIFVPATALQAAKEGART
FT                   LAMYVLMFAEWPFGMYTKTKQTTDNAGNNQSDQIFIHSESTVHIPGQKQMHIVLPRKVN
FT                   MVNPTTIAEANARVVIQPTYGTVAAGAGVANGNINVAAVGVALPTVNLTDYLVSWATDF
FT                   TLGDIKQLVERMKTTLPISRDLMAARQNAMLLSTLFPPLIQSNVASDTKEVPGTAGAYT
FT                   ACLANLGIPETLTVNWGVDINVQPLYQLLETDITAHNRYVLNLFKREEVVAGAYEFGWL
FT                   GHMASYMMGLLLTMNISSVFNVWYSTRRISTKAWDTAYDSNIQAYQDMHYQMFSWSSMQ
FT                   GSIAPAMVDEILHNLCGQMFGFSLPLRQVLFNALPITFSSFGSWMLPRVSDGFQTVRYY
FT                   DVGPPVINAKRDGEVPVSMIDAWTYKFTEKLPKSFLPWPMPEGKDSTMGYDPEKEPALI
FT                   DNSNETGNVFRPFMARNGNNSNYLPTNYTIDVSQNGHDESCINVDLFNNVAGVTLTNYD
FT                   GTATNADVVPTGSYIKQRAMPINANAVRPTETLDAANHTKPFAIEGGRLVYLGGTIANT
FT                   TNVVNAMQRKQRLSKPAFKWAHAQRQRVYDSSRPGMDAITKLCARKSGFMNARSTAMMA
FT                   PKTGLSAVIDQAPNTSQDLIEQPSQQEVMDMQATATV"
FT   CDS             5241. .7490
FT                   /codon_start=1
FT                   /product="RNA-dependent polymerase"
FT                   /note="ORF2; similar to Giardia lamblia virus gag-pol
FT                   fusion protein and Helicobasidium mompa virus RNA-dependent
FT                   RNA polymerase"
FT                   /db_xref="GOA:Q24M81"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:Q24M81"
FT                   /protein_id="AAT67231.2"
FT                   /translation="MDEIRNYTHLDYIFVQNICIYMLVFGIDTVKHFRQIGLFNERNEF
FT                   IEIAKQLSTKGKRFVDDVDNMKQKVCEIATIVGYMDPNVDKIDVMEEVNSLAAEGNEHG
FT                   IDRDNWNDLFTKTCKEVMTWYKGHEFISFDDYIKEGMWLTSGSSSIGKVHWTKDGENGK
FT                   FKARKNMLLQIYTPQELANIVYAWDGKLHSRVFIKNEMSKLRLAVASNIEAYIHESYML
FT                   FLYGHGFKEYFGVTLDEKPDQQHQREIEMIEKLQAGYFGLPFDYASFDHQPTTFEVKTM
FT                   VRRVGEIVVSQVPKNYYYQTQLLVNKIVNAYDKSYLSGNIKNTKFENIKVKGGVPSGVR
FT                   ITSLLGNMWNAIITKIAINNVIGIIGYDPISQISLRGDDVAILSKDPAALYLLRLSYAA
FT                   INAIGKDSKLGISPKVCEFLRNEISVTGVRGWTCRGIGGISQRKPWNPQPWSPNDEVET
FT                   NASNISLLERRAGIELQQLHHINKVKWSRHVRQSYKYLELPKRLGGFGIYRFQGWLPNG
FT                   KLPLAKKPLVNVEDIHPSQELFLPLSEQQKKILAQVEMTNKMQTDDIPGTQKLFSKEWI
FT                   QKVRAKKIIWSRNQTIPIHTDHTVRIPRWDEKIKFPRYKSEYILNNKINLTMEQVLRQY
FT                   NLLKEVERYDKDLKVPKLLDILDKWFPVQSSKIKTYESQGFHRTDAINLAVGEIPTEPA
FT                   VKINPILINFVKLHLERQGIRHQRGRNKIAKFIYQKTKQAENMILQSSLQQMYRY"
XX
SQ   Sequence 7561 BP; 2777 A; 1346 C; 1516 G; 1922 T; 0 other;

ay570982 Length: 7561  10-MAR-2013  Type: N  Check: 373  ..

       1  ggcaatttca acctaattct aaaactgtta ccaacaattt ctgaactaca
      51  gaagaggcat attcttcatc tacttcgaga agaagtagaa ggaaagaaag
     101  tttgcttcgt aaagcgagaa aaacagaatc cacttatggc tataaacgaa
     151  ctagccgtta aagttggaaa gaagcctaaa tacacatcga cgaaaaccgg
     201  agctgaccac attccaagct ggactgtatt ggttgagttc gcaggtttta
     251  gcgaagcagc aacatgtgac acagttaaaa acgcaaaaat gattgctgct
     301  tacaaattag ttaaaagatt ttgtaaatgg gacccaacct acattgaaat
     351  ttctgattgt atgctgccac ctccagacct tacatcgtgc ggggacgttg
     401  agagtaatcc tggacctatc atacatagcg ttgcatttgc aagaactggt
     451  tcagtatgga cacctgccac ctttactttc aatactacat catccccggg
     501  tagactgcaa gtacaaatgt catccagcga caatagatat gggttcaatt
     551  ctgttttact tgcagcaggt ggtacaacat ggggcacagc ttatttttca
     601  caacgttgga acagtgactt tggattacag ccagatctaa ctataactgt
     651  aacaccacaa ctaactggag aagaacttgg ttcaatttat tttgatgctg
     701  ttgaaactac aaatgcagag gaagctatag aggcaacaat tataaatact
     751  actccaattg atgtaatggt agacacaaca gcaggccctg taccaattga
     801  aggtgatttc aaacccacaa atgaaactcc cacgtgggta agtaacacaa
     851  agcccattga tgtagcaaca cctaagactc gtgactacgt aaatcggtca
     901  gtactgactc cacaactgat cacaaaaatg aaagaccatg tctatgcctt
     951  acaaaaggat gaagttaaag atgtaacact tgcctcactc gatttcggct
    1001  taaatccatc aagtgtactc ggaagatggt tgaaatggtt aactggcata
    1051  gacatgagac tccatcttgg gaagaaagtc acaaaccata aagttagaat
    1101  gtttgtgcaa aaaacaaggt ttccactaaa gacagcaatt gaggaactaa
    1151  acaatggtac tgttccacgt agattaagga gggatgttcg ttacattgaa
    1201  aagccgttcg ataaagagga acataccgat atactgttat ctggtgatgt
    1251  tgaggaaaac cccgggcctg aagggatgga acaggtatca ataacgccag
    1301  aacaacttca aatgattctg gcaatgcaaa aatcaccacc aaagccaaag
    1351  atcaaagaac taagtgaaag ggaaattcag ttaaggctcc aaggaaatga
    1401  agcaacccgc agacatcaaa gatttaaagg tgagcccatt gatccagttc
    1451  taactagaga agatataatt agaaagcaca atcagcagaa tggaatattg
    1501  cctgatgaaa aagaacagcc ggtagtggta aataacgtac accctttgga
    1551  gaaggagtat tccattgaaa aggaaggaat ggtgtgggac gaggaacaat
    1601  ttttgacgta tatacatgac aaatcatcaa gcaacgatca ctatgcctgc
    1651  atctataacg ttgttacaca taacagattc ggtgtacttg aaatgccaga
    1701  agatccactt gaaatgattg atcattatga accaggggaa gaaccaaaaa
    1751  caaaacctaa aactaaaagt ggtaacaaaa gagaactaaa tgatgaaacc
    1801  ttttacagaa agaagaagac aaaaacaaca aaagagccaa aaacacaaga
    1851  gcaaaagaaa attgaccacg ataacatgtt ttcacgattg ctgagaaggc
    1901  ttgacaaacc acaaattgta gcagcttggc taaacaacag accatcacgt
    1951  aaattggtcg aaaaattagc tgacagtaaa ttcggaattg gatggcaagc
    2001  aaaagaagag tacacaacca gcatggtaat tgtatctgga tatatcaatt
    2051  gtgaaccatt acccctaatc gtagataagc ttctctccgt cgataacaac
    2101  tatgacatgt ggcaacagac tgacaagtat tttgacaatt tgatcacact
    2151  gtgtaaccgc gtcagtgacg ttacctacac tagcgctcag ctgtgtagag
    2201  atgcatctat cttgaataac aagaagatgc atgttgaaaa tggaaacatt
    2251  gtttcaatgg aaaatcagtc tgaaattgat agtcaaacta aattcttttc
    2301  actgttagaa gatgataaca aacttccaat tgtagatgag ctaagagtat
    2351  tagctgatat gacggcacaa agaagcaacg taaacactgc tggtaatcat
    2401  cttcgtgata atgactctat tagggccgac gctgttctag ctaacaatac
    2451  agtacgtaac aattgtcaaa ttccaattcc tgtaacaaca ctaataccaa
    2501  gacaaattcg tggattgaat ggtgtacttg taaatcagca attacggtta
    2551  cagggaattg aaacacacat tacagacagt tatatttcaa aagctgagcc
    2601  atctgactat tcgaaacaac tgtctgaaat ggttaatgct caaaagacat
    2651  caacttggcg agcaaacaat atcgcatcac aggggtggga catgtttgat
    2701  actgtacagt taaatacaaa catatcacaa aaagatcttt caatggacac
    2751  tgctttgaca aagcttatgt tgttgtacca gctaacaaca caaaatctgc
    2801  cagcaacaca attaccatca agcatttatt ctgcatttga ttcaagaaca
    2851  cagcctactt tacaggatgg aatttggggt ataaataatg gtgttaatat
    2901  atttggtgaa caatgcggtg gattagccgc gccagtcttt ccattcagtg
    2951  ggggcaccgg agaaattact ttccatctta ctttacaatc tgttccacag
    3001  gaatttcaag aatcagcaat tttcgtacca gcaactgcac tacaagctgc
    3051  aaaagagggt gctcgaacat tggcaatgta tgttttaatg tttgcagaat
    3101  ggccatttgg tatgtataca aaaactaaac aaacaacaga caatgctggt
    3151  aataatcaat cagatcaaat tttcattcac tccgaatcta ctgtacatat
    3201  tccaggacaa aaacaaatgc atattgtgct gccaagaaaa gtgaacatgg
    3251  tgaaccccac tacaattgca gaagcaaatg cacgtgtagt aattcaacca
    3301  acatacggta cagtggcagc tggggcaggt gtcgcaaatg gtaatattaa
    3351  cgtagctgct gttggtgtgg ccctgccaac tgtaaatttg actgactatc
    3401  ttgtatcctg ggcaaccgat ttcacacttg gcgacataaa acaattggtt
    3451  gaaagaatga aaacaacact gccaattagt cgagacttga tggcagcacg
    3501  tcaaaatgct atgttattga gtactctatt tcctccacta attcagagca
    3551  atgtggcttc agacacaaag gaagtcccag gaacagctgg agcatacact
    3601  gcatgtcttg caaacttagg tattcctgaa acactaacag ttaactgggg
    3651  agtagatata aatgttcagc cattgtatca gctacttgaa acggacatca
    3701  cagcccacaa tcggtacgta ttaaacctgt tcaaaagaga agaagtggta
    3751  gcaggtgcat atgaatttgg gtggttggga cacatggcca gttatatgat
    3801  gggactcctt ctaacaatga atatatcatc agtgtttaac gtttggtatt
    3851  caacaagacg tatttcaaca aaggcgtggg acacagcata tgatagtaac
    3901  atccaagcat atcaggacat gcattatcaa atgttttcgt ggagttcaat
    3951  gcaaggtagt attgcaccag caatggtgga cgaaattctt cataaccttt
    4001  gtggccaaat gtttgggttc agcttaccat tgagacaagt cttatttaac
    4051  gcattgccaa tcactttttc atcgtttgga agttggatgt tgcctagagt
    4101  ttctgatggt ttccaaactg taaggtatta tgatgtaggt ccaccagtca
    4151  ttaatgcaaa acgtgatggg gaagtaccag taagtatgat tgacgcatgg
    4201  acctataaat ttacagaaaa attgccaaaa agttttttgc catggccaat
    4251  gccagaagga aaggacagta caatgggata tgatccggaa aaagaaccag
    4301  cactaattga taattcaaat gagacaggca atgtattcag accatttatg
    4351  gcaagaaatg gcaacaattc taattatttg ccaaccaact acacaattga
    4401  cgtatcacag aatggtcatg atgagagttg tattaatgtt gaccttttta
    4451  acaatgttgc aggagtaaca ctaacaaatt atgatggaac cgcaacaaac
    4501  gcagacgtcg taccaacagg atcatatatt aagcagagag caatgcctat
    4551  caatgcaaat gcggtacgac caactgaaac actcgacgct gctaaccata
    4601  caaaaccttt tgctattgaa ggaggaagac tcgtatattt gggtggaaca
    4651  attgcaaata caaccaatgt ggtaaacgca atgcagagga aacaaaggct
    4701  ttcaaaaccg gcattcaagt gggcacatgc tcagagacaa cgtgtatatg
    4751  acagcagtcg tccagggatg gacgcaatca caaagttgtg tgcacgaaag
    4801  tcgggtttta tgaatgcccg ttccacagca atgatggcac ccaagactgg
    4851  actcagcgct gttatagatc aagcaccaaa tacatctcaa gacttgatcg
    4901  aacagccgag tcagcaagag gttatggata tgcaagcgac agcaacagta
    4951  taaatcagat atatcaaatt gcattgcata gaaaggcaaa acttataaca
    5001  gcaaagaaat ggcaagaatt aacaaaaggt atttataatg catctaccct
    5051  gacaccgaag atagttgacc aaattataaa ggatgaagga agtgggaccg
    5101  ataagacaaa atatgtaaat gttcctaaaa taattactga caaagaatta
    5151  caaacattct atgtaccaag aagcaacgca gacctagtta taagaagaat
    5201  acgtttaatc gacctttggc gtaacctaaa accagatcaa atggacgaga
    5251  ttcgtaatta cactcatcta gattatatct ttgtacaaaa catttgtatc
    5301  tatatgttag tatttggaat agacacagtt aaacacttta gacaaatagg
    5351  tctattcaat gaaaggaatg aatttattga aattgcaaaa cagttatcaa
    5401  ccaaagggaa aagatttgtt gatgatgttg ataatatgaa acaaaaggta
    5451  tgtgaaatag ctactattgt tggttatatg gacccaaatg ttgataaaat
    5501  agacgtaatg gaagaagtca actcactcgc agctgaaggt aatgaacatg
    5551  gtatagatag agataattgg aatgatttgt ttacaaaaac atgcaaagaa
    5601  gtaatgacat ggtacaaagg acatgaattt attagttttg atgattacat
    5651  aaaggaagga atgtggttaa caagtggaag ttcaagtatt gggaaagtgc
    5701  attggacaaa agatggagaa aatgggaaat ttaaagcaag gaaaaatatg
    5751  ctgttacaaa tttatacacc gcaagaattg gccaacattg tttatgcttg
    5801  ggatggaaag ttacattcac gtgtctttat taaaaacgaa atgagtaaat
    5851  taagacttgc tgtggcatct aacatcgaag catatattca tgaatcttat
    5901  atgcttttcc tatatggtca tggttttaaa gaatactttg gagtgacgct
    5951  tgacgaaaaa ccagatcaac agcatcagag agaaattgaa atgattgaga
    6001  aactacaagc tggatacttt ggattaccat ttgactatgc atcatttgat
    6051  catcagccaa caactttcga agttaagaca atggtgagaa gagttggaga
    6101  aattgtagtt agtcaagtac ctaagaatta ttactatcag acacaattgc
    6151  tagtcaataa gattgttaat gcatatgata aaagttattt gtctggaaat
    6201  attaaaaata caaaatttga aaatataaaa gtcaaaggtg gagtaccatc
    6251  aggagtgaga ataacgagtt tgttgggtaa tatgtggaac gctataatta
    6301  caaagatcgc aataaataat gttattggaa ttattggata cgacccaatc
    6351  tcccaaatct cgttacgcgg agacgacgtt gctatattaa gtaaagatcc
    6401  agcagctctt tatttactta gactatcata tgctgcaatt aatgcaattg
    6451  gcaaagatag taagttaggt atatctccaa aagtatgtga atttttacgg
    6501  aatgagatat cagtgacagg agtacgcggt tggacatgta gaggaatagg
    6551  tggcataagt caacgaaaac catggaatcc acaaccttgg agtccaaatg
    6601  atgaagtcga aacaaatgca agcaacattt cattattaga aagacgagca
    6651  ggaattgaac ttcaacaatt acaccacata aacaaagtta aatggtcgag
    6701  acacgtcaga caaagttata aatatctaga attgccaaaa cgacttggtg
    6751  gttttggaat ctatcgattc caggggtggt tacctaacgg caaattacca
    6801  cttgccaaaa agcccttggt taacgtagag gacatacatc caagccaaga
    6851  gctgtttttg cctttaagtg aacaacagaa aaagatctta gcacaggttg
    6901  aaatgacaaa caaaatgcaa acagatgata tacctgggac acaaaaatta
    6951  ttttcaaagg aatggataca gaaagtgcgt gcaaaaaaga tcatatggag
    7001  tagaaatcag acaataccaa tccatactga tcacacagta cgtataccaa
    7051  gatgggacga gaaaatcaaa ttcccaaggt ataaatcaga atatatatta
    7101  aataataaaa tcaacttaac aatggagcaa gtgctaagac agtataacct
    7151  cctaaaagaa gtggaacggt acgataaaga tctaaaagtg ccaaagttat
    7201  tagacatttt ggacaaatgg ttcccggtcc aaagtagtaa aattaaaaca
    7251  tatgaaagtc aaggttttca tagaacagac gcaattaacc ttgctgttgg
    7301  tgaaattcca actgaaccag cagttaaaat aaatcctata ctaataaact
    7351  ttgtcaagtt acatcttgaa agacaaggta ttagacatca gagaggtaga
    7401  aataagatcg ccaaatttat ttaccaaaaa acaaaacaag cagagaacat
    7451  gatactgcaa agtagtttac aacaaatgta taggtactaa attaagggac
    7501  caataaagaa acttcgagtt tcctataaca cattcccagt tgggttttgt
    7551  ggccagccat g