Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus, complete genome.

ACC No: AY579432

Dated: 2005-04-16 | Length: 4766 | CRC: -1524928290

                !!NA_SEQUENCE 1.0
ID   AY579432   standard; genomic RNA; VRL; 4766 BP.
XX
AC   AY579432;
XX
SV   AY579432.1
XX
DT   31-DEC-2004 (Rel. 82, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Tomato bushy stunt virus, complete genome.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4766
RA   Ohki T., Uematsu S., Lesemann D.-E., Honda Y., Tsuda S., Fujisawa I.;
RT   "Characterization of Tomato bushy stunt virus newly isolated from
RT   nipplefruit in Japan";
RL   J. Gen. Plant Pathol. 71:74-79(2005).
XX
RN   [2]
RP   1-4766
RA   Ohki T.;
RT   ;
RL   Submitted (22-MAR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Disease Protection, National Agricultural Research
RL   Center, 3-1-1 Kannondai, Tsukuba, Ibakaki 305-8666, Japan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4766
FT                   /country="Japan"
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Tomato bushy stunt virus"
FT                   /specific_host="nipplefruit"
FT   CDS             164. .2620
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5IZF4"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q5IZF4"
FT                   /note="RNA-dependent RNA polymerase; readthrough stop codon
FT                   of 33k protein"
FT                   /transl_except=(pos:1052. .1054,aa:OTHER)
FT                   /product="92k protein"
FT                   /protein_id="AAT67237.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFLVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATKV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRTGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARTPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYNGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTAK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFRAK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQYEHSFYRAMYPGNKLLSKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVYGYMRHLGINEFSLANCGDDCVLIVER
FT                   RNLKQIQRTLPEYFLNLGYTMKVEAPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVERFYSRFTLYDTPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPEARASFWAAFGLTGDEQLALEDRLDRWEMDLFGIEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             164. .1054
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5IZF3"
FT                   /note="ORF1"
FT                   /product="33k protein"
FT                   /protein_id="AAT67235.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFLVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATKV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             2644. .3810
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5IZF2"
FT                   /db_xref="UniProt/TrEMBL:Q5IZF2"
FT                   /note="capsid protein"
FT                   /product="41k protein"
FT                   /protein_id="AAT67236.1"
FT                   /translation="MAMTTRNNNNVLAVSKKQLGVLAASAAAGALRNYISESGPALLQS
FT                   AVGLGKKALNKVRNRRKQGNQQIITHVGGVGGSIMAPVAVSRQLVGSKPKFTGRTSGSV
FT                   TVTHREYLTQVNNSSGFVVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYSFNNVVLH
FT                   YVPLCGTTEVGRVALYFDKDSQDLEPADRVELANFGVLKETAPWAEAMLRIPTDKVKRY
FT                   CNDSSTVDQKLIDLGQLGIATYGGAGTNAVGDVFISYSVTLYFPQPTNTLLSTRRLDLT
FT                   GTLAGAAGPGYLVLTRTPTVLTHTFRATGTFNLSGGLRCLTSLTLGATGAVVINDILAI
FT                   DNVGTASAYFLNCTVSSLPATVTFTTTGISSATVNVVRSTRANVINLL"
FT   CDS             3846. .4415
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5IZF1"
FT                   /db_xref="UniProt/TrEMBL:Q5IZF1"
FT                   /note="movement protein"
FT                   /product="22k protein"
FT                   /protein_id="AAT67234.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLMVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRFRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVKWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASKTDSSA"
FT   CDS             3878. .4396
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5IZF0"
FT                   /db_xref="UniProt/TrEMBL:Q5IZF0"
FT                   /product="19k protein"
FT                   /protein_id="AAT67233.1"
FT                   /translation="MERAIQGNDAREQAYGERWNGGSGGSTSPFKLPDESPSWTEWRLH
FT                   NDETIPNQDNPLGFKESWGFGKVVFKRYLRYDGTETSLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSVTISGGSRTLQHLSEMAIRSKQELLQLTPVKVESDVSRGCPEG
FT                   AETFKEESE"
XX
SQ   Sequence 4766 BP; 1251 A; 1016 C; 1300 G; 1199 T; 0 other;

 AY579432  Length: 4766  April 19, 2005 08:53  Type: N  Check: 8550  ..

       1  agaaattctc caggatttct cgacctagtt cggtatctgg tgatttgcgc
      51  tatctgttgc tttgcgtaga gaatttctct cctttatcac ttgtgatttg
     101  ggggtttgaa ggctgggtct acctttcgag gggataaatt gtaacttcca
     151  gcaaataagc gacatggaga ccatcaagag aatgatttgg cctaagaaag
     201  aaatttttgt gggtgatttc gcgatcggag ttaataggac ggcaccggtg
     251  gacatcttcc agttggtgtg tcgtgtggtt ctgagataca tgaggacagg
     301  gaaaatagag tgtgattccg acagcatgac gaagtttttg gttgaattgc
     351  tcaaaactga ttgtgctgcc aaatgggagt ggtttatgaa gagacggcag
     401  aggggtgatt acattgtccc tctatctata gcctctatcc cgatcatacc
     451  gctgttgagt tatgccacga aggtacgcgc agtctcagtc aaggcgtttg
     501  gtaatgaact ttcgttcaac gttagagtgc ccagaccatc tgtacctaag
     551  aaaggattgc tcctcagact ggcggcaggc ttagcactcg cacctatatg
     601  cgcgctagct gtgtacgcta ccctacccag ggaaaaactg tcggtattta
     651  agctgagaac tgaggcacgt gcacacatgg aggatgagag agaagcgaca
     701  gattgtttgg tggttgagcc ggcacgggaa ctcaagggta aagatggtga
     751  ggatctcctc actggtagta gaatgactaa ggtaattgcg tccacggggc
     801  gccctcgcag acggccttat gcagcgaaaa tcgcacaggt cgcgagagct
     851  aaggtgggtt accttaagaa cactcctgaa aacaggttga tctaccagcg
     901  agtcatgata gagatcatgg acaaagactg cgtcaggtat gttgacaggg
     951  atgtcatatt gcccttggcc attggatgct gttttgtcta tccggatgga
    1001  gtggaggagt cggcggcact ttggggttcc caggaatccc ttggtgtcaa
    1051  atagggaggc ctagtacgtc tacctggggt tgtaacacag atcaatcgag
    1101  atatcccatc tgatgtgttg cttccccagg aggtgctaga ggttcgtaca
    1151  ggacctccca atgctaagga ccgtaatata tttatggttg caggttgccc
    1201  atcacaggca cggttcttag tgcataatca ctgcctgaaa aaccttaaaa
    1251  ggggtcttgt ggagagagtc ttctgcgtag agagaaacgg gaagctcgct
    1301  cgcactccac aacctaccaa aggagccttt ggacgtcttt ccccgttcag
    1351  gaaagcagtt tgtgagaagg ttggagtagc ccaccgactt gggtatgatg
    1401  gattcctgtc atactacaac ggcgcgaaac tccgtactta cacacgagct
    1451  gtggagagtc tgcatatcac tcctgtttct gagagggaca gtcatttgac
    1501  taccttcgtg aaagcagaga agatatcgac ggccaagggt gacccagcac
    1551  ctagggtgat acagcctcga aaccctaggt acaatgtgga acttgggaga
    1601  tatctacggc atatggaatc caagctgatg aaagctgttg atggcgtgtt
    1651  cggagaaaca acatgcatca agggatatac cgctgatgag gtgggtgcta
    1701  tctttcgagc gaaatgggac aggtttgata aacctgtagc catagggctc
    1751  gatgcatcca ggttcgatca acactgttcc gtggaagcac tgcaatatga
    1801  acatagcttc tacagggcca tgtaccctgg caacaaactg ttaagtaagt
    1851  tgttggaatg gcaactccat aataaaggta aaggttacgt cccggacgga
    1901  accattacgt atcggaagga gggttgccga atgagtgggg atataaacac
    1951  ctcgttgggg aattatctat tgatgtgtgc gatggtatat ggatacatgc
    2001  gtcatctggg gataaatgag tttagtctgg cgaactgcgg agatgactgt
    2051  gttctaattg tggaacgcag gaatctcaag cagatacaga ggacactacc
    2101  tgagtacttc ttaaatttag ggtacacaat gaaggtagaa gcccctgtat
    2151  ttcaattgga agaggttgaa ttctgccagg cacacccagt acagtttcag
    2201  ggcggttgga agatggttcg caatgtccgt actgctatga gcaaagatgt
    2251  gcactgtgta aataatatac gcgatttggc gacgaggagg gcctggagta
    2301  acgcccaaca tcatggaggc ctggcactca gtgccggcat acctgttgtg
    2351  gagcgatttt actccaggtt tacactctat gacactcctc gtaaacatca
    2401  acgtattgac actgtcacaa atgttcacaa gtggcgcggc tctggtggaa
    2451  gttatgttgt gacacctgaa gcgagggcta gcttttgggc agccttcggt
    2501  ttgacggggg atgagcaact ggctctggag gatcgtctgg atagatggga
    2551  gatggattta tttggaattg aaggtgttga cgctcacgag cccagcatcc
    2601  ttgattccgc cgtagcttga ccaagtatac actaacacaa gagatggcga
    2651  tgacaacgag aaataacaac aatgtgctcg ctgtgagcaa gaaacagttg
    2701  ggggtcctag cagcatctgc tgctgcaggg gctctgcgta attatattag
    2751  tgagagtggc ccagcactgc tacaatcagc agtgggtttg ggaaagaagg
    2801  ccttaaataa ggtgaggaat cgaaggaaac agggaaatca gcagatcatt
    2851  actcatgttg gtggcgttgg gggctcaatc atggctcctg tggcggtgtc
    2901  caggcaacta gtaggtagta agccgaaatt taccggaagg acatctggat
    2951  ctgtcacagt tacgcaccgt gagtacctta ctcaagtaaa caattcttca
    3001  ggattcgtgg taaatggggg tattgtcggc aatttgttac aactcaatcc
    3051  gttgaatgga acactgttct cgtggctgcc tgccatagca tccaattttg
    3101  atcagtactc atttaacaac gttgtgttac attacgtccc cctgtgcggc
    3151  accactgaag tagggcgtgt agcgctatac tttgataagg actcacaaga
    3201  tcttgagcct gctgatagag tggagttggc gaactttggt gttctaaaag
    3251  agacagcccc atgggctgag gcgatgctgc gcatacccac tgacaaagtt
    3301  aagagatact gtaatgacag ttccacagtt gatcagaaac ttatagattt
    3351  gggacagctt ggtatcgcta cttatggagg agcaggtaca aatgctgtag
    3401  gggatgtgtt catctcctac agtgtcacac tgtactttcc tcaacccacc
    3451  aacaccctgt tgagtacacg acggcttgac cttaccggaa ctttggccgg
    3501  tgctgctgga cctgggtatc ttgtcctgac aagaactccc acagtcttga
    3551  cgcacacttt tagggcaact ggtaccttca acctctctgg aggtttgagg
    3601  tgtttgacca gtctcactct cggagcaacg ggggcggtgg ttatcaatga
    3651  catacttgct attgacaatg tgggcacggc tagcgcctac tttctcaatt
    3701  gcacggtatc ctctctacct gccaccgtaa cattcacaac aactggaata
    3751  tcttccgcca ccgtcaacgt ggtgcgtagt acacgagcca atgttattaa
    3801  cttactgtaa tctcttgtga ggggcctctt gaacaagacc agttcatgga
    3851  tactgaatac gaacaagtca ataaaccatg gaacgagcta tacaaggaaa
    3901  cgacgctagg gaacaagctt atggtgaacg ttggaatgga ggatcaggag
    3951  gttccacttc tcccttcaaa cttcctgacg aaagtccgag ttggactgag
    4001  tggcggctac ataacgatga gacgattccg aatcaagata atccccttgg
    4051  tttcaaggaa agctggggtt tcgggaaagt tgtatttaag agatatctca
    4101  gatacgacgg gacggaaact tcattgcaca gagtccttgg atcttggacg
    4151  ggagattcgg ttaactatgc agcatctcga tttttcggtt tcgaccagat
    4201  cggatgtacc tatagtattc ggtttcgagg agttagtgtc accatttctg
    4251  gagggtcgcg aactcttcag catctcagtg aaatggcaat tcggtctaag
    4301  caagaactgt tacagcttac cccagtcaaa gtggaaagtg atgtatcaag
    4351  aggatgccct gaaggtgctg aaaccttcaa agaagaaagc gagtaagaca
    4401  gactcttctg cctgagttcg cggatacaag tgtgaatcta acaacgcata
    4451  caggttactc ttgttgggtt ctggatgtta tgatgacgag tcggtcgggc
    4501  tccgcactgg gtttggtcgc ccaggggatg gagatatgga aagggtctcg
    4551  tgtgctatca gtcggtcgaa agacgcgctt gcaacatggg cctataaccg
    4601  gataagtcat agcaatacca gccaacatga attggatgcc tgtttacggg
    4651  acttaggtgt cactagtgga aacgcaccca ggcgcggttg atctcaccct
    4701  tcgggggggc tatagagatc gctggaagca ctaccggaca accggaacat
    4751  tgcagaaatg cagccc