Sequence of DPV Citrus tristeza virus

Citrus tristeza virus subclone comunibb9 minor coat protein (p27) gene, complete cds.

ACC No: AY598362

Dated: 2005-04-30 | Length: 724 | CRC: -1857117521

                !!NA_SEQUENCE 1.0
ID   AY598362   standard; genomic RNA; VRL; 724 BP.
XX
AC   AY598362;
XX
SV   AY598362.1
XX
DT   30-APR-2005 (Rel. 83, Created)
DT   30-APR-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Citrus tristeza virus subclone comunibb9 minor coat protein (p27) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   "Analysis of population variability of p27 gene in geographically and
RT   biologically diverse Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   ;
RL   Submitted (13-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamente de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires B1876BXD, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .724
FT                   /country="Brazil"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Barao B"
FT                   /sub_clone="comunibb9"
FT   gene            2. .724
FT                   /gene="p27"
FT   CDS             2. .724
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AAT99807.1"
FT                   /translation="MAGYTVLPKTDDKEMDPVSAAVPGKCPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIVSKFTDRETPNALRKYACTFEESHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLSLRDLGKYL"
XX
SQ   Sequence 724 BP; 217 A; 129 C; 168 G; 210 T; 0 other;

   AY598362  Length: 724  May 3, 2005 09:03  Type: N  Check: 5107  ..

       1  catggcaggt tatacagtac ttcctaagac tgacgataaa gaaatggatc
      51  cggtgagtgc cgctgtgccc ggtaagtgcc cggatgttat tgaaaaattt
     101  gtggcaaata ggtctgtaga tgcgttaata gaaggcgtta taagtaagtt
     151  ggataccaat tcgatatacg aagattccac tgaaaagttt actggtgagt
     201  acttaaagta cgttatggtt actatggaca ctttcttatt agaaaactat
     251  aaaacgaaaa cggaagatct gttagttcac ttagctatga tccaaaagag
     301  gttatgtacc atatccacga gtactaaaac taagttccgc gataagggtt
     351  gtattagtta cgtacaagga ggtttacgat acaagttatt ggataaagtg
     401  gtttttcctt ttattgtatc gaaatttacc gacagggaga ctccgaatgc
     451  tctacgtaag tatgcttgca ctttcgagga gtcacactta tgtatggcta
     501  gattaagacc cgacctatac gagaataaaa ggacgaccaa ggctgggact
     551  ccacatttaa aaggttactt atcagctgac tttctttcgg gttctctccc
     601  agggtactct gagcatgaac gaggcattat tcttcgagcg tccgaatcta
     651  tgttagctag acgtcaaggt tacgaggagg caaccgagct tcttagccta
     701  cgtgatttgg gtaagtactt atag