Sequence of DPV Citrus tristeza virus

Citrus tristeza virus subclone comunipera minor coat protein (p27) gene, complete cds.

ACC No: AY598364

Dated: 2005-04-30 | Length: 724 | CRC: -463056170

                !!NA_SEQUENCE 1.0
ID   AY598364   standard; genomic RNA; VRL; 724 BP.
XX
AC   AY598364;
XX
SV   AY598364.1
XX
DT   30-APR-2005 (Rel. 83, Created)
DT   30-APR-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Citrus tristeza virus subclone comunipera minor coat protein (p27) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   "Analysis of population variability of p27 gene in geographically and
RT   biologically diverse Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   ;
RL   Submitted (13-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamente de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires B1876BXD, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .724
FT                   /country="Brazil"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Pera GS"
FT                   /sub_clone="comunipera"
FT   gene            2. .724
FT                   /gene="p27"
FT   CDS             2. .724
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AAT99809.1"
FT                   /translation="MAGYTVLPKIDDKEMDPVSAAVPGKYPDVVEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 724 BP; 212 A; 138 C; 174 G; 200 T; 0 other;

   AY598364  Length: 724  May 3, 2005 09:03  Type: N  Check: 821  ..

       1  catggcaggt tatacagtac ttcctaagat cgatgacaaa gaaatggatc
      51  cggtgagtgc cgccgtgccc ggtaagtatc cggatgtcgt tgagaaattt
     101  gtggccaata ggtccgtaga tgcgttaata gaaggcgtta taagtaagtt
     151  ggataccaat tcaatatacg aggattccac tgaaaaattt actggtgaat
     201  acttgaaata cgtcatggtt actatggata ctttcttatt agaaaactac
     251  aagacgaaaa cggaagatct gttggttcac ttagctatga tccaaaagag
     301  gttgtgcact atatccacga gcactaaaac caagttccgc gataaaggtt
     351  gtattagtta cgtgcaaggg ggttcgcggt ataagttaat ggataaagta
     401  gtttttcctt tcattatatc gaaatttacc gatagggaga ccccgaacgc
     451  tctacgtaag tatgcttgca ctttcgagga gttacactta tgtatggcta
     501  ggttgagacc cgacttatac gaaaataaaa ggacgaccaa agccgggact
     551  ccgcatttaa agggctactt atcagccgac tttctttcgg gttctctccc
     601  agggtactcg gaacatgagc gaggcatcat tcttcgagcg tctgagtcta
     651  tgttagctag acgtcaaggt tacgaggagg caaccgagct tcttaatcta
     701  cgcgatttgg gtaagtactt atag