Sequence of DPV Citrus tristeza virus

Citrus tristeza virus subclone comunit385 minor coat protein (p27) gene, complete cds.

ACC No: AY598367

Dated: 2005-04-30 | Length: 724 | CRC: 3869314

                !!NA_SEQUENCE 1.0
ID   AY598367   standard; genomic RNA; VRL; 724 BP.
XX
AC   AY598367;
XX
SV   AY598367.1
XX
DT   30-APR-2005 (Rel. 83, Created)
DT   30-APR-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Citrus tristeza virus subclone comunit385 minor coat protein (p27) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   "Analysis of population variability of p27 gene in geographically and
RT   biologically diverse Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   ;
RL   Submitted (13-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamente de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires B1876BXD, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .724
FT                   /country="Spain"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="T385"
FT                   /sub_clone="comunit385"
FT   gene            2. .724
FT                   /gene="p27"
FT   CDS             2. .724
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AAT99812.1"
FT                   /translation="MAGYTVLPNTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLCTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 724 BP; 216 A; 143 C; 168 G; 197 T; 0 other;

   AY598367  Length: 724  May 3, 2005 09:03  Type: N  Check: 8958  ..

       1  catggcaggt tatacagtac ttcctaatac cgatgacaaa gaaatggatc
      51  cggtgagtgc cgctgtaccc ggtaagtatc cggatgtcat tgaaaaattt
     101  gtggccaaca ggtccgtaga cgcgttaata gaaggcgtca taagtaagtt
     151  ggataccaat tcaatatacg aagattccac tgaaaaattt actggtgaac
     201  acttgaaata cgttatggtt actatggatg ctttcttatt agaaaactac
     251  aagacgaaaa cggaagatct gttggttcac ttggctatga tccaaaagag
     301  gttgtgcact acatccacga gcactaaaac caagttccgc gataaaggtt
     351  gtattagtta cgtgcaaggg ggttcgcgat acaagttaat ggataaagta
     401  gtttttcctt tcattatatc gaaatttacc gacagggaga ctccgaacgc
     451  tctacgtaag tatgcttgca ccttcgagga gttacacttg tgtatggcta
     501  ggttgagacc cgacttatac gaaaataaaa ggacgactaa agccgggact
     551  ccacatttaa agggctattt atcagccgac tttctttcgg gttctctccc
     601  agggtactcc gaacatgaac gaggcatcat tcttcgagcg tctgagtcta
     651  tgttagctag acgtcaaggt tacgaggagg caaccgagct tcttaaccta
     701  cgtgatttgg gtaagtactt atag