Sequence of DPV Citrus tristeza virus

Citrus tristeza virus subclone comunit388 minor coat protein (p27) gene, complete cds.

ACC No: AY598369

Dated: 2005-05-01 | Length: 724 | CRC: 1685501387

                !!NA_SEQUENCE 1.0
ID   AY598369   standard; genomic RNA; VRL; 724 BP.
XX
AC   AY598369;
XX
SV   AY598369.1
XX
DT   30-APR-2005 (Rel. 83, Created)
DT   01-MAY-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus subclone comunit388 minor coat protein (p27) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   "Analysis of population variability of p27 gene in geographically and
RT   biologically diverse Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-724
RA   Gago-Zachert S., Costa N., Grau O., Semorile L.;
RT   ;
RL   Submitted (13-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamente de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires B1876BXD, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .724
FT                   /country="Spain"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="T388"
FT                   /sub_clone="comunit388"
FT   gene            2. .724
FT                   /gene="p27"
FT   CDS             2. .724
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AAT99814.1"
FT                   /translation="MAGYTVLPNTDDKEMNPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLPGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEAAELLNLRDLGKYL"
XX
SQ   Sequence 724 BP; 217 A; 142 C; 167 G; 198 T; 0 other;

  AY598369  Length: 724  May 10, 2005 10:09  Type: N  Check: 8720  ..

       1  catggcaggt tatacagtac ttcctaatac cgacgacaaa gaaatgaatc
      51  cggtgagtgc cgctgtgccc ggtaagtatc cggatgtcat tgaaaaattt
     101  gtgaccaata ggtccgtaga cgcgttaata gaaggcgtta taagtaagct
     151  ggataccaat tcaatatacg aagattccac tgaaaaattt actggtgaat
     201  acttgaaata cgttatggtt actatggata ctttcttatt agaaaactac
     251  aagacgaaaa cggaagatct gttggttcac ctagctatga tccaaaagag
     301  gttgtgcact atatccacga gcactaaaac caagttccgc gataaaggtt
     351  gtattagtta cgtgcaaggg ggttcgcgat ataagttaat ggataaagta
     401  gtttttcctt tcattatatc gaaatttacc gatagggaga ctccgaacgc
     451  tctacgtaag tatgcttgca ctttcgagga gttgcacttg tgtatggcta
     501  ggttgagacc cgacttatac gaaaataaaa ggacgaccaa agccgggact
     551  ccacatttaa aaggctactt atcagccgac tttcttccgg gttctctccc
     601  agggtactcc gaacatgaac gaggcatcat tcttcgagcg tctgagtcta
     651  tgttagctag acgtcaaggt tacgaggagg cggccgagct tcttaaccta
     701  cgtgatttgg gtaagtactt atag