Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Ir.n.1 major coat protein gene, complete cds.

ACC No: AY608507

Dated: 2005-12-11 | Length: 672 | CRC: -288855779

                ID   AY608507   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY608507;
XX
SV   AY608507.1
XX
DT   23-JUN-2005 (Rel. 84, Created)
DT   11-DEC-2005 (Rel. 86, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate Ir.n.1 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Alavi V., Khatabi B., Salekdeh G.H.;
RT   "Comparison of biologically distinct isolates of Citrus tristeza virus from
RT   Iran using major coat protein sequences";
RL   Australas. Plant Pathol. 34(4):577-582(2005).
XX
RN   [2]
RP   1-672
RA   Khatabi B., Alavi S.V., Ghareyazie B., Bananej K., Salekdeh G.H.;
RT   ;
RL   Submitted (26-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Proteomics, Agricultural Biotechnology (ABRII), Mahdasht Road, Karj, Tehran
RL   31535-1897, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="Iran:northern"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Ir.n.1"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="GOA:Q4QY47"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QY47"
FT                   /product="major coat protein"
FT                   /protein_id="AAT48094.1"
FT                   /translation="MDDETKKLKNKIKETEEGDDVVAAESSFGSLNLHIDPTLIAKNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYVQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 124 C; 174 G; 180 T; 0 other;

ay608507 Length: 672  11-DEC-2005  Type: N  Check: 1849  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaatcaagg aaacggaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgaagaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  atatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgataa
     351  actttggact gatgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc ggatatcatt acctgtgcgc agatttcttg accggagctg
     551  gcttgactga cttggaatgt gctgtgtacg tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga