Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Ir.n.3 major coat protein gene, partial cds.

ACC No: AY608509

Dated: 2005-12-11 | Length: 671 | CRC: -2074491002

                
ID   AY608509   standard; genomic RNA; VRL; 671 BP.
XX
AC   AY608509;
XX
SV   AY608509.1
XX
DT   23-JUN-2005 (Rel. 84, Created)
DT   11-DEC-2005 (Rel. 86, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate Ir.n.3 major coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-671
RA   Alavi V., Khatabi B., Salekdeh G.H.;
RT   "Comparison of biologically distinct isolates of Citrus tristeza virus from
RT   Iran using major coat protein sequences";
RL   Australas. Plant Pathol. 34(4):577-582(2005).
XX
RN   [2]
RP   1-671
RA   Khatabi B., Alavi S.V., Ghareyazie B., Bananej K., Salekdeh G.H.;
RT   ;
RL   Submitted (26-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Proteomics, Agricultural Biotechnology (ABRII), Mahdasht Road, Karj, Tehran
RL   31535-1897, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .671
FT                   /country="Iran:northern"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Ir.n.3"
FT   CDS             1. .>671
FT                   /codon_start=1
FT                   /db_xref="GOA:Q4QY45"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QY45"
FT                   /product="major coat protein"
FT                   /protein_id="AAT48096.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYVQAKEQLLKKRGADEVVVTMSGSLGNSTH
FT                   V"
XX
SQ   Sequence 671 BP; 194 A; 125 C; 173 G; 179 T; 0 other;

ay608509 Length: 671  11-DEC-2005  Type: N  Check: 7921  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  atatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgataa
     351  actttggact gatgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc ggataccatt acctgtgcgc agatttcttg accggagctg
     551  gcttgactga cttggaatgt gctgtgtacg tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactatgt caggcagctt
     651  gggaaattca acacacgttg a