Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Ir.n.7 major coat protein gene, complete cds.

ACC No: AY608513

Dated: 2005-12-11 | Length: 672 | CRC: -1767176103

                
ID   AY608513   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY608513;
XX
SV   AY608513.1
XX
DT   23-JUN-2005 (Rel. 84, Created)
DT   11-DEC-2005 (Rel. 86, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate Ir.n.7 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Alavi V., Khatabi B., Salekdeh G.H.;
RT   "Comparison of biologically distinct isolates of Citrus tristeza virus from
RT   Iran using major coat protein sequences";
RL   Australas. Plant Pathol. 34(4):577-582(2005).
XX
RN   [2]
RP   1-672
RA   Khatabi B., Alavi S.V., Ghareyazie B., Bananej K., Salekdeh G.H.;
RT   ;
RL   Submitted (27-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Proteomics, Agricultural Biotechnology (ABRII), Mahdasht Road, Karj, Tehran
RL   31535-1897, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="Iran:northern"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Ir.n.7"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="GOA:O10474"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:O10474"
FT                   /product="major coat protein"
FT                   /protein_id="AAT48100.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 126 C; 175 G; 178 T; 0 other;

ay608513 Length: 672  11-DEC-2005  Type: N  Check: 1612  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagcga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gatgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc gggtatcatt acctgtgcgc agatttcttg accggagctg
     551  gcttgactga cttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga