Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate PV-0193, complete genome.

ACC No: AY613852

Dated: 2006-01-11 | Length: 3884 | CRC: 43150202

                
ID   AY613852   standard; genomic RNA; VRL; 3884 BP.
XX
AC   AY613852;
XX
SV   AY613852.1
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   11-JAN-2006 (Rel. 86, Last updated, Version 3)
XX
DE   Pelargonium line pattern virus isolate PV-0193, complete genome.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-3884
RX   DOI; 10.1007/s00705-004-0464-y.
RX   PUBMED; 15645374.
RA   Castano A., Hernandez C.;
RT   "Complete nucleotide sequence and genome organization of Pelargonium line
RT   pattern virus and its relationship with the family Tombusviridae";
RL   Arch. Virol. 150(5):949-965(2005).
XX
RN   [2]
RP   1-3884
RA   Castano A., Hernandez C.;
RT   ;
RL   Submitted (30-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Molecular and Celular Plant Biology, Spanish Higher Research
RL   Council, Avenida De Los Naranjos S/N, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3884
FT                   /country="Germany"
FT                   /db_xref="taxon:167019"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pelargonium line pattern virus"
FT                   /isolate="PV-0193"
FT                   /specific_host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT   5'UTR           1. .6
FT   gene            7. .2304
FT                   /gene="p87"
FT   CDS             7. .2304
FT                   /codon_start=1
FT                   /db_xref="GOA:Q56TL0"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProtKB/TrEMBL:Q56TL0"
FT                   /note="p87 is a putative readthrough protein of p27"
FT                   /transl_except=(pos:727. .729,aa:OTHER)
FT                   /gene="p87"
FT                   /product="RNA dependent-RNA polymerase"
FT                   /protein_id="AAU84998.1"
FT                   /translation="MAHYFGEALQLGLFVAKASCWASKELALLGPNLAWIATRPLRNDA
FT                   NAILKRIGVHGLAKIPCNFDSDELTIANDCIVKSDRNLEDESIVVEEVEEGEEKKKSKK
FT                   VTRRRVKTKPTFAAVLAADAKNYYGCLPSATRANELSVMKYLVSKCQEHKLTITQTREV
FT                   SAMAFALTFTPDENDKLIYKYLNSTEVFERRVDYAKARGVDKCWFELLKRPWHARAWRR
FT                   VVGRIFGLPEQQAFEFVKXGCLMDTCGVDTKVYRGEHRWVKEFRGAANPKPRRLYKISG
FT                   VSPEVRWGVHNNSFVNLRRGLMERVFYVERSGELLPCPSPEAGLFKRLFNKVGRRVIRF
FT                   CGHHSPIPRASYPGMFQGRKRTIYENAVRSLVDRPYNIRDSYLKTFVKFEKLDFSKKPD
FT                   PAPRVIQPRHPRYNVELGRYLKPFEHFCYKALDKLWGGPTVMKGYTVEEMGGIIKDSWL
FT                   QFQKPVAIGFDMSRFDQHVSVDALKFEHSIYKACFSKDGNLATLLGHQISNRGSAYAND
FT                   GYLRYRVEGKRMSGDVNTGLGNCLLACTITKFLMEEIGVRSRLVNNGDDCVLICEAGDC
FT                   RAVEGSLTVGWRRFGFTCIAEKPVYELEKIEFCQMSPIQISDSRVKLVRKPQKSISKDA
FT                   HSTTPLTTIQLAQEWTRAIGEGGLSLTSGIPVVQEFYQCLIRNGKKATKESKKMAFYGD
FT                   YYWKWVNQHSGKYEPVTEEARHSFHLAFGVSPDQQLALEDIYSRKSLLWESSPFTFEVG
FT                   AIEWIFNQKIPI"
FT   gene            7. .729
FT                   /gene="p27"
FT   CDS             7. .729
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/TrEMBL:Q56TK9"
FT                   /gene="p27"
FT                   /product="replicase protein"
FT                   /protein_id="AAU84997.1"
FT                   /translation="MAHYFGEALQLGLFVAKASCWASKELALLGPNLAWIATRPLRNDA
FT                   NAILKRIGVHGLAKIPCNFDSDELTIANDCIVKSDRNLEDESIVVEEVEEGEEKKKSKK
FT                   VTRRRVKTKPTFAAVLAADAKNYYGCLPSATRANELSVMKYLVSKCQEHKLTITQTREV
FT                   SAMAFALTFTPDENDKLIYKYLNSTEVFERRVDYAKARGVDKCWFELLKRPWHARAWRR
FT                   VVGRIFGLPEQQAFEFVK"
FT   gene            530. .913
FT                   /gene="p13"
FT   CDS             530. .913
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/TrEMBL:Q56TK8"
FT                   /gene="p13"
FT                   /product="p13"
FT                   /protein_id="AAU84999.1"
FT                   /translation="MKMTNSSTNTSIQPRCLNDGWIMPRRAGLTSAGLNCSRGLGMLEH
FT                   GGEWLGGFSDCLSSRLSSSSNRDASWTLAVWTRKCTAGNTAGLRSSVGRQTPSRVGCIR
FT                   LVGYPLKLDGGCTTIVLSTSEEG"
FT   gene            2274. .2611
FT                   /gene="p12"
FT   CDS             join(2274. .2463,2463. .2611)
FT                   /codon_start=1
FT                   /db_xref="GOA:Q56TK7"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q56TK7"
FT                   /note="shares amino terminus with p7"
FT                   /gene="p12"
FT                   /product="p12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /ribosomal_slippage
FT                   /protein_id="AAU85002.1"
FT                   /translation="MDIQSKDSNLSVKEAGKSAKRGSTKNKLDVAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLNFLISCHSHTRYTLIYLSALCCASSLVQFLARDRVIVIVTFQL
FT                   APVINSSQ"
FT   gene            2274. .2465
FT                   /gene="p7"
FT   CDS             2274. .2465
FT                   /codon_start=1
FT                   /db_xref="GOA:Q56TK6"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q56TK6"
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="AAU85000.1"
FT                   /translation="MDIQSKDSNLSVKEAGKSAKRGSTKNKLDVAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLNF"
FT   gene            2441. .2611
FT                   /gene="p6"
FT   CDS             2441. .2611
FT                   /codon_start=1
FT                   /db_xref="UniProtKB/TrEMBL:Q56TK5"
FT                   /note="non-canonical start codon"
FT                   /transl_except=(pos:2441. .2443,aa:Met)
FT                   /gene="p6"
FT                   /product="p6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU85001.1"
FT                   /translation="MCGPSQFLISCHSHTRYTLIYLSALCCASSLVQFLARDRVIVIVT
FT                   FQLAPVINSSQ"
FT   gene            2621. .3637
FT                   /gene="p37"
FT   CDS             2621. .3637
FT                   /codon_start=1
FT                   /db_xref="GOA:Q56TK4"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q56TK4"
FT                   /gene="p37"
FT                   /product="coat protein"
FT                   /protein_id="AAU85003.1"
FT                   /translation="MAAKDNPAVIAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPTNARRARGEPGNAKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNHKYETAAHKPLLVTLPVSKETRFLRDKCTDDSKLVDSGAVHVLVDGSHEGRLGELF
FT                   FELTIVFSEPTFCTHHSQVIKGLKESEGPEYVKVEPDKETVKLIFQAAGAYLISIVASK
FT                   LERIGQLGASEGDKLVVESTDKSACLCRIEAEQPGSAVVLVYASREAITLRAYINKL"
FT   3'UTR           3638. .3884
XX
SQ   Sequence 3884 BP; 1035 A; 894 C; 1068 G; 887 T; 0 other;

ay613852 Length: 3884  11-JAN-2006  Type: N  Check: 7904  ..

       1  aacaaaatgg cacactattt tggggaggca ctgcaattgg gcctgtttgt
      51  tgctaaggcc agctgctggg ccagtaagga gttggcgctc ctcggtccta
     101  acttggcctg gatagctact agaccacttc gcaacgatgc taatgccatc
     151  ctaaagcgga ttggcgtcca tgggttggcc aaaatcccgt gcaacttcga
     201  ctccgatgag ttaacgatcg caaatgactg cattgtgaag tccgacagga
     251  acttggagga tgaatcgatc gtggtggagg aggtcgagga gggggaggag
     301  aagaagaaga gcaagaaggt gacaaggagg agggtgaaaa ccaagcctac
     351  cttcgcggcc gtcctggcgg ctgacgcgaa gaattattac ggttgcctcc
     401  cgagtgccac cagggcaaac gagctcagcg tcatgaagta cctagtttcg
     451  aagtgtcaag agcacaagct gaccataact cagacacgag aggtaagtgc
     501  catggctttt gcgttgacct tcacgccgga tgaaaatgac aaactcatct
     551  acaaatacct caattcaacc gaggtgtttg aacgacgggt ggattatgcc
     601  aaggcgcgcg gggttgacaa gtgctggttt gaattgctca agaggccttg
     651  gcatgctcga gcatggagga gagtggttgg gcggattttc ggactgcctg
     701  agcagcaggc tttcgagttc gtcaaatagg gatgcctcat ggacacttgc
     751  ggtgtggaca cgaaagtgta ccgcggggaa caccgctggg ttaaggagtt
     801  ccgtggggcg gcaaacccca agccgcgtag gttgtataag attagtgggg
     851  tatcccctga agttagatgg ggggtgcaca acaatagttt tgtcaacctc
     901  agaagagggt taatggaaag ggttttctac gtcgaaagat caggggaact
     951  cctaccgtgt ccgtctccgg aggctggttt gtttaaacgg ttgttcaaca
    1001  aggttgggcg gcgggtgatt aggttttgcg gccatcattc cccgatccct
    1051  agggcttcgt accctgggat gtttcagggc aggaaacgca cgatttatga
    1101  aaacgcagtc cggtcccttg ttgaccgacc ttacaatatt agggatagct
    1151  atttaaaaac ttttgtcaag tttgaaaaat tagactttag caagaaacct
    1201  gatcccgcgc ctagggtaat ccaacccagg catccgaggt acaacgtaga
    1251  actaggaaga tatctgaagc cttttgagca tttctgctac aaggcactag
    1301  acaagttgtg gggagggccc accgttatga aaggatacac agttgaggaa
    1351  atgggaggga ttatcaagga cagctggctc caattccaga aaccagtagc
    1401  tattggcttc gacatgagtc gattcgatca acatgtttct gtggatgccc
    1451  tgaagtttga gcacagcatt tacaaggctt gcttctcgaa agatgggaat
    1501  ctggcaactt tgctaggtca ccaaatatct aacagaggct ctgcttatgc
    1551  taatgatggc tacttgagat atagagtgga agggaaaagg atgagcgggg
    1601  acgtgaacac cgggctgggc aattgcttgt tggcgtgcac tatcacaaaa
    1651  tttttgatgg aagaaattgg cgtgaggtct agactggtga acaacgggga
    1701  cgactgcgtg cttatatgtg aggccggaga ttgccgcgct gtcgagggta
    1751  gcttgacagt ggggtggcga cggtttggct tcacctgcat agcggaaaaa
    1801  cccgtttacg agctggaaaa gatcgaattc tgtcaaatga gccctataca
    1851  gattagtgat tcccgcgtca agctagtgag gaaaccccag aaaagcatat
    1901  ctaaagatgc acattccacc acccccctca ccaccataca gctagctcaa
    1951  gaatggaccc gcgctatcgg agaaggcggg ctgtctctga ccagcggcat
    2001  cccagtggtt caggaattct accaatgcct catccgtaac ggaaagaaag
    2051  cgacaaagga atcaaagaaa atggccttct acggggacta ctattggaag
    2101  tgggttaacc agcatagcgg caagtatgaa ccggtgactg aggaagctcg
    2151  gcattcattc cacttggcgt ttggggtcag ccctgaccaa cagttggccc
    2201  tagaggacat atactctcgc aagtcgctac tttgggagtc ctcccccttt
    2251  acatttgaag ttggcgctat cgaatggata ttcaatcaaa agattccaat
    2301  ctaagtgtaa aggaagcagg gaaatcagca aagcgcggaa gcacaaagaa
    2351  caagctggac gtagctcaca gtggagtatc caagggtaca tctcgcgatc
    2401  ttgtcggtgc taatttcgtc acagttgctg ataaagtgga atttgtggtc
    2451  catctcaatt tctgatttct tgccacagcc acactcgtta caccctaatt
    2501  tacttgtctg cattgtgttg tgcatcttct ttagttcagt tcttagccag
    2551  ggacagagtt atagttatag ttacttttca actagcacca gtgataaatt
    2601  catctcagta gctgtaggaa atggcggcca aggataatcc ggcagtcatc
    2651  gcagccgtgg caaggcggga acagtgggca atcaagctcc aatccaaggg
    2701  ttggggctca ttgtccaaag cacagaaagc cactgctcgc tcgtacggga
    2751  tcgggaaccc tccaacagtc gtggtgcctc gcactacccg gctggtggca
    2801  gggaatccca caaatgcgag gcgggcgcgg ggagagccgg gtaatgccaa
    2851  aatgggcacc accataacca agcaggaata catgggcgag cttcattctt
    2901  cttcaaagat tgaaacttac ttgctcgacc ccaagaatgt gaggagcttc
    2951  cctcagttaa gcgggcttgc aatcggctac aacaagtaca agatcactga
    3001  cttcaaggtg cgatacagtc ctaaatgtag cgacagtgag tgtgggttga
    3051  ccatagctta ctctagcgac tcttccgatc caccgccgaa gaacaaattc
    3101  aacttgttta gcatgaatca caagtatgaa acagccgcgc acaagccact
    3151  cctagtgaca cttcccgtat ccaaagagac cagattcttg cgggacaagt
    3201  gtactgatga ttccaaactc gtagacagtg gggcggtgca tgtcctggtg
    3251  gacgggagcc acgaaggcag gctcggagaa cttttcttcg agttaaccat
    3301  cgtgttttct gaaccaacct tctgcaccca ccactcccaa gtcatcaaag
    3351  gactcaagga gagtgaaggg cccgaatacg ttaaggttga gcctgacaag
    3401  gagaccgtga aacttatctt ccaggcggca ggggcatacc taatttctat
    3451  agtggcctct aaactagagc gaatcgggca gcttggtgct tctgaaggtg
    3501  acaagctggt agttgagagt actgataaga gtgcctgcct ctgtagaata
    3551  gaggcggagc aaccaggtag tgctgtagta ttagtttatg ccagcaggga
    3601  ggctattacc ctgcgagctt acatcaacaa gctgtgagga aagccactgc
    3651  ggtggggtca gtctcctggt gcgccaacac ccagaagggg agacaacttc
    3701  agtggttcaa aacccgatgc ttcgtgtaag cctagaaaaa tccaaaaaca
    3751  gagtgctact gctttcagtg tgcgagcttt atttgctcac ttcctccgtc
    3801  gataaaatcc cgaattttcg ggtgggcttc ggcggacatc cttaatgaag
    3851  aacggggggg taacccaccc ccctgatctg cccg