Sequence of DPV Olive mild mosaic virus

Olive mild mosaic virus, complete genome.

ACC No: AY616760

Dated: 2006-05-09 | Length: 3683 | CRC: 1022628783

                ID   AY616760   standard; genomic RNA; VRL; 3683 BP.
XX
AC   AY616760; AY263376;
XX
SV   AY616760.1
XX
DT   30-MAR-2005 (Rel. 83, Created)
DT   09-MAY-2006 (Rel. 87, Last updated, Version 3)
XX
DE   Olive mild mosaic virus, complete genome.
XX
KW   .
XX
OS   Olive mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus; unclassified Necrovirus.
XX
RN   [1]
RP   1-3683
RX   DOI; 10.1007/s00705-003-0258-7.
RX   PUBMED; 15168200.
RA   Cardoso J.M., Felix M.R., Oliveira S., Clara M.I.;
RT   "A Tobacco necrosis virus D isolate from Olea europaea L.: viral
RT   characterization and coat protein sequence analysis";
RL   Arch. Virol. 149(6):1129-1138(2004).
XX
RN   [2]
RP   1-3683
RX   DOI; 10.1007/s00705-004-0453-1.
RX   PUBMED; 15592885.
RA   Cardoso J.M., Felix M.R., Clara M.I., Oliveira S.;
RT   "The complete genome sequence of a new necrovirus isolated from Olea
RT   europaea L.";
RL   Arch. Virol. 150(4):815-823(2005).
XX
RN   [3]
RP   1-3683
RA   Cardoso J.M.S., Felix M.R., Oliveira S., Clara M.I.E.;
RT   ;
RL   Submitted (27-MAR-2003) to the EMBL/GenBank/DDBJ databases.
RL   ICAM (Instituto de Ciencias Agrarias Mediterranicas), Universidade de
RL   Evora, Apartado 94, Evora 7002-554, Portugal
XX
RN   [4]
RP   1-3683
RA   Cardoso J.M.S., Felix M.R., Clara M.I.E., Oliveira S.;
RT   ;
RL   Submitted (04-MAY-2004) to the EMBL/GenBank/DDBJ databases.
RL   ICAM (Instituto de Ciencias Agrarias Mediterranicas), Universidade de
RL   Evora, Apartado 94, Evora 7002-554, Portugal
XX
CC   On May 8, 2006 this sequence version replaced gi:32765794.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3683
FT                   /organism="Olive mild mosaic virus"
FT                   /specific_host="Olea europaea L."
FT                   /isolate="GP"
FT                   /mol_type="genomic RNA"
FT                   /country="Portugal"
FT                   /db_xref="taxon:295090"
FT   CDS             60. .2234
FT                   /codon_start=1
FT                   /transl_except=(pos:666. .668,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="read-through stop codon"
FT                   /db_xref="GOA:Q58ZJ7"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ZJ7"
FT                   /protein_id="AAU93817.1"
FT                   /translation="MELTNHHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVKFQQALLSI
FT                   EDTEHFEDINECLEESAGAQSQRTKVVAEGAYSPVKTNRTRRVRKQKKAKFVKYLVNEA
FT                   RAEFGLPKATEANRLMVQHFLLRTCKEWGVVTSQCHNNVALALNLVFIPTEDDLLSRAL
FT                   MNTYATQAAVNGMTNTQGEGWWNNRLGIGSQVGLAFRAKXGCLERRPGFSTSVSRGEHP
FT                   DLVVKPSGHPEKQRQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFYVEGPNGLQDAP
FT                   KPDKGAFNSLAKFRDLYTKNSWRHSPVTNEQFLMNYSGRKLTIYKDAVDSLSRQPLSLR
FT                   DARLKTFVKAEKLNLSKKPDPAPRVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEI
FT                   TVFKGFTLEQQGEIMHSKWKKYVNPVAVGLDASRFDQHVSREALEYEHEFYLRDYPNDK
FT                   QLKWLLKQQLSNVGTAFASDGIIKYKKEGCRMSGDMNTSLGNCILMCAMVFGLKEHLGM
FT                   ELSLANNGDDCVIVCEKADLLKLTSSIEPYFRQFGFKMEVEKPVDIFERIEFCQTQPVF
FT                   DGSQYIMVRKPSVVTSKDVTSLIPCQTQSQYAEWLQAVGECGMSINGGIPVMQNFYTML
FT                   QTGVKRTKFTKTGEFQTNGLGYHSRFMNRVARTPSPETRLSFYLAFGITPDLQEALEVF
FT                   YDTSTLELDDVIPTDTYQVSGEHLINGLPN"
FT   CDS             60. .668
FT                   /codon_start=1
FT                   /product="p23"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ZJ6"
FT                   /protein_id="AAU93815.1"
FT                   /translation="MELTNHHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVKFQQALLSI
FT                   EDTEHFEDINECLEESAGAQSQRTKVVAEGAYSPVKTNRTRRVRKQKKAKFVKYLVNEA
FT                   RAEFGLPKATEANRLMVQHFLLRTCKEWGVVTSQCHNNVALALNLVFIPTEDDLLSRAL
FT                   MNTYATQAAVNGMTNTQGEGWWNNRLGIGSQVGLAFRAK"
FT   CDS             852. .2234
FT                   /codon_start=1
FT                   /product="p52"
FT                   /db_xref="GOA:Q58ZJ5"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ZJ5"
FT                   /protein_id="AAU93816.1"
FT                   /translation="MERVFYVEGPNGLQDAPKPDKGAFNSLAKFRDLYTKNSWRHSPVT
FT                   NEQFLMNYSGRKLTIYKDAVDSLSRQPLSLRDARLKTFVKAEKLNLSKKPDPAPRVIQP
FT                   RSPRYNVCLGRYLRHYEHHAFKTIAKCFGEITVFKGFTLEQQGEIMHSKWKKYVNPVAV
FT                   GLDASRFDQHVSREALEYEHEFYLRDYPNDKQLKWLLKQQLSNVGTAFASDGIIKYKKE
FT                   GCRMSGDMNTSLGNCILMCAMVFGLKEHLGMELSLANNGDDCVIVCEKADLLKLTSSIE
FT                   PYFRQFGFKMEVEKPVDIFERIEFCQTQPVFDGSQYIMVRKPSVVTSKDVTSLIPCQTQ
FT                   SQYAEWLQAVGECGMSINGGIPVMQNFYTMLQTGVKRTKFTKTGEFQTNGLGYHSRFMN
FT                   RVARTPSPETRLSFYLAFGITPDLQEALEVFYDTSTLELDDVIPTDTYQVSGEHLINGL
FT                   PN"
FT   CDS             2218. .2439
FT                   /codon_start=1
FT                   /product="p8"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ZJ4"
FT                   /protein_id="AAU93818.1"
FT                   /translation="MDYQTDINEDNVSISGRARRGTGDKKHNGSGMSGVKRHAVSETAQ
FT                   KSQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   CDS             2443. .2613
FT                   /codon_start=1
FT                   /product="p6"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ZJ3"
FT                   /protein_id="AAU93819.1"
FT                   /translation="MAVCRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   CDS             2636. .3445
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q58ZJ2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ZJ2"
FT                   /protein_id="AAU93820.1"
FT                   /translation="MPKRGRVGLAESFQGKTKQQKRAEYEAVKREQLERAFANNSKVAN
FT                   PRSSGLSFRPLVAPIAGSVVYSRPRVPQIRTNQMSTIVVNTELVANITLAAAGAFSFTA
FT                   QPLIPSFGSWLANIADLYSKWRWIRCSVIYIPKCPTTTQGSVVMAIVYDAQDTVPTTRT
FT                   QVSQCYQSITFPPYAGYGGASALNSNSSGGESLVSTLDTNRVDKKWYSTIGNAAFTALT
FT                   SIDKNQFCPATALIAGDGGPVAATAVGDVFMRYEIEFIEPINPTINV"
XX
SQ   Sequence 3683 BP; 1041 A; 874 C; 900 G; 868 T; 0 other;

ay616760 Length: 3683  09-MAY-2006  Type: N  Check: 1008  ..

       1  agtatacata ccaagtatac ggaataggtg tgaacccttg ctcagctaaa
      51  gaggataaaa tggagctcac taaccaccac aagcaaactg ctgctgaagg
     101  atttgtaagc tttctgaact ggctttgtaa cccatggaga cgacaacgaa
     151  cagtcaacgc tgctgttaag ttccaacagg ctctcctctc aatagaggat
     201  actgaacact tcgaggacat caacgaatgc ctcgaggagt ctgctggagc
     251  ccaatcacag cgaactaagg ttgtcgccga aggggcatat tctcccgtca
     301  aaaccaatcg tacccgccga gtccgcaagc agaagaaggc caagtttgtc
     351  aagtacttgg tcaatgaggc tcgtgccgag tttggtctac ccaaagccac
     401  tgaggccaat cgacttatgg tacaacactt cttgctcaga acgtgtaagg
     451  aatggggtgt ggtcacctcc caatgtcaca acaacgttgc acttgcgtta
     501  aacctagtgt tcatcccaac tgaagatgac ctgctgtccc gagcactgat
     551  gaacacttac gccacgcaag ctgctgtgaa tggaatgacc aacacccaag
     601  gggaggggtg gtggaacaac cgacttggga ttggatccca ggttggactg
     651  gccttccggg ccaaataggg gtgcctagag aggaggccag ggttctccac
     701  gtccgtttcg cgtggagagc accctgatct ggtggtcaaa ccatcaggac
     751  accccgagaa acagcgccag ttgctgcgct atagtggaat tggcggccat
     801  ttactaattg gcatccacaa caactctctc tccaatttgc gccggggctt
     851  aatggaaaga gtattctacg tcgagggacc caatgggctc caagacgccc
     901  cgaaacccga caagggagcc ttcaactccc ttgctaagtt cagagatctc
     951  tatacaaaga atagctggcg tcattcccct gtaaccaatg agcaattttt
    1001  gatgaattac tcgggcagga agctaactat ttacaaggat gcggtcgaca
    1051  gtttgtcgcg tcaaccgctt agcctaagag atgctcggct gaagacattc
    1101  gttaaggcgg aaaaattgaa tctgagtaag aaaccagatc cagcaccgag
    1151  ggtcattcag cctcggtcgc cccgctataa cgtatgtttg ggtcgttatc
    1201  ttcgtcacta tgaacatcac gcgtttaaaa ccattgctaa atgctttggg
    1251  gaaatcacgg tcttcaaagg attcactctc gagcaacaag gtgaaatcat
    1301  gcactccaag tggaagaaat atgttaatcc cgttgcggtc ggtctcgatg
    1351  ccagtcgatt cgatcaacac gtgtctaggg aagcacttga gtacgagcat
    1401  gaattttatt tgagagatta tcctaatgat aaacagctaa aatggttgct
    1451  taagcaacaa ttgagtaatg taggcacagc attcgctagc gacggaatca
    1501  taaagtacaa gaaagaggga tgtagaatga gtggggacat gaacacaagt
    1551  ttgggaaact gcatattgat gtgcgccatg gtctttgggc taaaagaaca
    1601  cttaggaatg gaattgtcat tggctaacaa tggggatgac tgcgtcattg
    1651  tctgtgagaa agcggattta ttgaaattga cgagcagcat cgaaccatat
    1701  ttcagacagt tcggattcaa aatggaagtg gaaaagcctg tagacatctt
    1751  tgagcgcatt gaattttgcc aaacccaacc tgtgttcgat ggctcccaat
    1801  acattatggt taggaaaccc tccgttgtaa cttccaaaga tgtcactagc
    1851  ttaataccgt gccaaacaca atctcaatac gcagaatggc tgcaagctgt
    1901  tggtgagtgc ggtatgagca taaatggtgg aatacctgtc atgcagaatt
    1951  tctacaccat gttgcaaact ggcgtaaagc gcacaaaatt caccaagacc
    2001  ggcgagttcc agacgaatgg gctggggtat cactctcgat ttatgaacag
    2051  ggtggcccga actccttcgc ctgagacccg tttatccttt tacttagcgt
    2101  ttggtatcac accagacctc caggaagcat tggaggtctt ctatgatacc
    2151  agtacgcttg aattggatga tgtgatccca actgatacct accaagtgtc
    2201  aggagagcat ttaatcaatg gattaccaaa ctgatatcaa cgaagataac
    2251  gtgagcataa gcggtcgggc caggaggggc actggggaca agaaacacaa
    2301  tggttcggga atgtctggcg taaagcgtca tgcggtgagt gaaacagctc
    2351  agaaatcgca gcaaggtact ggcaatggca caatgaccaa catagctgaa
    2401  gaacagacca ttaccgtgac atacaacttt aacttttgag ttatggctgt
    2451  gtgtcgctgc tgtgatactt caccaggtat tacattattc ccttactttg
    2501  caattctcat cctcatcctt gcaatactag ttgttggaac tccaaaccag
    2551  caatatcatc attctcctag cacttacgag tacaagactc aacacatttc
    2601  gatcgcaaaa tagacattta ctataacacc aaaacatgcc taagagagga
    2651  cgagttggac tcgctgaatc ttttcaagga aagacgaagc aacagaaacg
    2701  ggcagagtac gaagctgtaa aacgtgagca gctcgaacgt gcattcgcaa
    2751  acaattccaa ggtagccaat cctagatctt ctgggctaag cttccgaccg
    2801  ttggtggcac caatcgccgg gtccgttgtt tacagcagac ctcgcgtgcc
    2851  acagatccgc acgaaccaaa tgtcaactat tgtggtaaac actgaattgg
    2901  tagccaacat cactttggct gctgctggag cattcagttt caccgcccag
    2951  ccattgatac catcatttgg atcttggttg gccaacatag ctgacttgta
    3001  ctcaaaatgg agatggatta ggtgttcagt catatacata cctaaatgtc
    3051  ccaccaccac tcaaggtagt gtggttatgg cgattgtgta tgatgcgcag
    3101  gacaccgtac ctacgacacg aacgcaggta tcacagtgtt atcaatccat
    3151  cacatttcca ccgtacgccg ggtacggtgg cgcctctgcg ctaaatagca
    3201  acagctctgg aggggaatcg ctagtgtcta cacttgacac caatcgcgtt
    3251  gataagaagt ggtacagcac aataggcaac gctgccttca ctgctctcac
    3301  atctatcgac aagaaccagt tctgtccagc cacagctctc attgctgggg
    3351  acggcggacc tgtggctgcc acagctgtgg gcgatgtatt tatgcgatat
    3401  gagattgagt tcatcgaacc aatcaaccct accattaacg tttgagtgtt
    3451  agttaactgg cttaaaccct aagggtagat atgtgggcgg taagcaagag
    3501  ggatcctggg aaacaggctt cgacgggttg ggggtggtgc cccggccgac
    3551  gcatcacttg ctgatacaac cattagacac ctaagggcgg gtctagccag
    3601  gtctccacgc catgatcaat tggaaacgat tgtgaggggg gtagtggaac
    3651  ccataccaga ttgaggggcc tttgccccac ccc