Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Nuevo Leon 1994 p13 gene, complete cds.

ACC No: AY652892

Dated: 2004-07-21 | Length: 360 | CRC: 2057842409

                !!NA_SEQUENCE 1.0
ID   AY652892   standard; genomic RNA; VRL; 360 BP.
XX
AC   AY652892;
XX
SV   AY652892.1
XX
DT   21-JUL-2004 (Rel. 80, Created)
DT   21-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Nuevo Leon 1994 p13 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-360
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular analysis of Citrus tristeza virus isolates from Mexico";
RL   Unpublished.
XX
RN   [2]
RP   1-360
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   ;
RL   Submitted (14-JUN-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biotecnologia y Bioquimica, Centro de Investigacion y Estudios Avanzados,
RL   Km. 9.6 Lib. norte carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .360
FT                   /country="Mexico:State of Nuevo Leon"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="field isolate collected in 1994 and preserved in
FT                   greenhouses of the Direccion General de Sanidad Vegetal,
FT                   SAGARPA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Nuevo Leon 1994"
FT   CDS             1. .360
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AAT74391.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
XX
SQ   Sequence 360 BP; 93 A; 66 C; 81 G; 120 T; 0 other;

 AY652892  Length: 360  August 10, 2004 12:11  Type: N  Check: 6557  ..

       1  atgagtattc gacgcgtgtg gttaaaggtt atagctgtaa ttacagtgtt
      51  gtggtacggt aaggaacctt ctattagtga aggttacaat gctcttatga
     101  atgacgactt taaatttatc gatacgcatt tttctaacgt ttcttatgct
     151  aagaaatgtt acgatttggc caatttcgat ttagactttt tgcgcatcgt
     201  tatcattcct ttgagtggtg gcacggcgaa tgaatcgcgt tctgatcgca
     251  ctaacgtttc agagattgtc gaatcgcatg taagcgaccg agacagaatg
     301  cacatcttgt tgcgtaataa gcggatccag attccttcgc tcttaccttg
     351  cgataactag