Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Baja California 1997 p13 gene, complete cds.

ACC No: AY652899

Dated: 2004-07-21 | Length: 360 | CRC: -1167449787

                !!NA_SEQUENCE 1.0
ID   AY652899   standard; genomic RNA; VRL; 360 BP.
XX
AC   AY652899;
XX
SV   AY652899.1
XX
DT   21-JUL-2004 (Rel. 80, Created)
DT   21-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Baja California 1997 p13 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-360
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular analysis of Citrus tristeza virus isolates from Mexico";
RL   Unpublished.
XX
RN   [2]
RP   1-360
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   ;
RL   Submitted (14-JUN-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biotecnologia y Bioquimica, Centro de Investigacion y Estudios Avanzados,
RL   Km. 9.6 Lib. norte carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .360
FT                   /country="Mexico:State of Baja California Norte"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="field isolate collected in 1997 and preserved in
FT                   greenhouses of the Direccion General de Sanidad Vegetal,
FT                   SAGARPA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Baja California 1997"
FT   CDS             1. .360
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AAT74398.1"
FT                   /translation="MSIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NISYAKKCYDLANFDLDFLRVVVIPLSGSTANESRADRTNISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCGN"
XX
SQ   Sequence 360 BP; 98 A; 67 C; 80 G; 115 T; 0 other;

 AY652899  Length: 360  August 10, 2004 12:11  Type: N  Check: 4129  ..

       1  atgagtattc gacgtgtgtg gttaaaggtt gtggctgtaa ttacggtatt
      51  atggtacggt aaggaacctt ccattagcga aggttacaac gctcttatga
     101  atgatgactt taagtttatc gacacgcatt tttcaaacat ttcttatgct
     151  aagaaatgtt acgatctggc taatttcgat ttagactttc tacgcgtcgt
     201  tgtcattcct ttaagtggta gtacggcgaa tgaatcgcgt gctgatcgca
     251  ctaatatttc agaaattgtc gaatcgcatg taagcgaccg agacagaatg
     301  aacattttgt tgcgtaacaa gcggatccaa atcccatcgc tcttaccttg
     351  cggtaactag