Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Baja California 1997 p23 gene, complete cds.

ACC No: AY652901

Dated: 2004-07-24 | Length: 630 | CRC: 1825261980

                !!NA_SEQUENCE 1.0
ID   AY652901   standard; genomic RNA; VRL; 630 BP.
XX
AC   AY652901;
XX
SV   AY652901.1
XX
DT   24-JUL-2004 (Rel. 80, Created)
DT   24-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Baja California 1997 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular analysis of Citrus tristeza virus isolates from Mexico";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P., Martinez-Soriano J.P.;
RT   ;
RL   Submitted (14-JUN-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biotecnologia y Bioquimica, Centro de Investigacion y Estudios Avanzados,
RL   Km. 9.6 Lib. norte carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /country="Mexico:Baja California Norte"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="field isolate collected in 1997 and preserved in
FT                   greenhouses of the Direccion General de Sanidad Vegetal,
FT                   SAGARPA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Baja California 1997"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAT75271.1"
FT                   /translation="MDSTSGQTFVSVNLSDESNTASTAVRTVSSEADRLEFLRKMNPFV
FT                   IDALVRKTSYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAYMLMHDP
FT                   VKYLNKGKARAFSNAEMFAIDLVMYTKEKQLAVSLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDTNAVDVGDNEDTSSEYPVSLSVSDGVLREHHFI"
XX
SQ   Sequence 630 BP; 187 A; 126 C; 163 G; 154 T; 0 other;

 AY652901  Length: 630  August 10, 2004 12:11  Type: N  Check: 9330  ..

       1  atggatagta ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcaagtactg cagttagaac cgtaagttcg gaagctgatc
     101  gcttggaatt tttacggaaa atgaacccct ttgtcatcga cgctttggta
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcaaaaa taataggagt
     201  gtgcgtagat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caacaacaca caatctcaga acgaggtggc gtatatgtta
     301  atgcacgatc ccgttaagta tttaaataag ggaaaggcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaggaaaagc
     401  agttggcggt tagtttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccga tgcgttctcc ggaagaaact ccggaacact ataaattcgg
     501  tatgactgct aaagcaatgt taccggacac caacgctgtg gacgttggtg
     551  ataacgagga cacttcgtcg gagtacccag tgagtctgag tgtttctgac
     601  ggagttctcc gtgaacacca cttcatctga