Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Nuevo Leon 1994 p23 gene, complete cds.

ACC No: AY652902

Dated: 2004-07-24 | Length: 630 | CRC: 857752368

                !!NA_SEQUENCE 1.0
ID   AY652902   standard; genomic RNA; VRL; 630 BP.
XX
AC   AY652902;
XX
SV   AY652902.1
XX
DT   24-JUL-2004 (Rel. 80, Created)
DT   24-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Nuevo Leon 1994 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular analysis of Citrus tristeza virus isolates from Mexico";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P., Martinez-Soriano J.P.;
RT   ;
RL   Submitted (14-JUN-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biotecnologia y Bioquimica, Centro de Investigacion y Estudios Avanzados,
RL   Km. 9.6 Lib. norte carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /country="Mexico:Nuevo Leon"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="field isolate collected in 1994 and preserved in
FT                   greenhouses of the Direccion General de Sanidad Vegetal,
FT                   SAGARPA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Nuevo Leon 1994"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAT75272.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAETFAIELVLYTKEKQLAVDLAAEREKARLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPEFNAVGVGDIEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 184 A; 124 C; 166 G; 156 T; 0 other;

 AY652902  Length: 630  August 10, 2004 12:11  Type: N  Check: 775  ..

       1  atggacgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcgagtacta gagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatccct tcattattga cgctctggtg
     151  cggaaaacta attatcaggg cgctcgcttt cgtgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaagta tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag acgtttgcga ttgaattggt tttgtacacc aaggaaaagc
     401  aattggcggt tgatttggcc gccgaaaggg agaaggcgag gttggctcgt
     451  agacacccaa tgcgttctcc agaggaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcgatgt taccggaatt caacgctgta ggcgttggtg
     551  atatcgaaga cacttcgtcg gaatacccag taagtctgag tgtttccggt
     601  ggagttctcc gtgaacacca cttcatctga