Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Colima 1997 p23 gene, complete cds.

ACC No: AY652906

Dated: 2004-07-24 | Length: 630 | CRC: 1650424283

                !!NA_SEQUENCE 1.0
ID   AY652906   standard; genomic RNA; VRL; 630 BP.
XX
AC   AY652906;
XX
SV   AY652906.1
XX
DT   24-JUL-2004 (Rel. 80, Created)
DT   24-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Colima 1997 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular analysis of Citrus tristeza virus isolates from Mexico";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Herrera-Isidron L., Hernandez-Valencia M.C., Sanchez-Briseno V.,
RA   Iturriaga-Garciduenas D.R., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P., Martinez-Soriano J.P.;
RT   ;
RL   Submitted (14-JUN-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biotecnologia y Bioquimica, Centro de Investigacion y Estudios Avanzados,
RL   Km. 9.6 Lib. norte carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /country="Mexico:Colima"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="field isolate collected in 1997 and preserved in
FT                   greenhouses of the Direccion General de Sanidad Vegetal,
FT                   SAGARPA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Colima 1997"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAT75276.1"
FT                   /translation="MDDTNGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVSYTKERQLAVDLAAEREKTRLARRHTIRSPEETPEH
FT                   YKFGMTAKAMLPNINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 191 A; 128 C; 162 G; 149 T; 0 other;

 AY652906  Length: 630  August 10, 2004 12:11  Type: N  Check: 7179  ..

       1  atggatgata ctaacggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacacg gcaagcacta aagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatccct ttattgttga cgctctggtg
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcaagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaacacg caatctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaagta tttgaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaactggt ttcgtacacc aaggaaaggc
     401  aactggcggt cgatttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacacaa tacgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccgaacat caacgccgta gacgttggtg
     551  ataacgagga aacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga