Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 15-118 coat protein mRNA, complete cds.

ACC No: AY660009

Dated: 2005-04-16 | Length: 672 | CRC: -1941061720

                !!NA_SEQUENCE 1.0
ID   AY660009   standard; mRNA; VRL; 672 BP.
XX
AC   AY660009;
XX
SV   AY660009.1
XX
DT   31-DEC-2004 (Rel. 82, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 15-118 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Marques N., Bailey A., Niblett C.L., Nolasco G.;
RT   "Differentiation of Citrus tristeza virus (CTV) isolates by cleavase
RT   fragment length polymorphism (CFLP) analysis of the major coat protein
RT   gene";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Bonacalza B., Sequeira Z., Nolasco G.;
RT   ;
RL   Submitted (18-JUN-2004) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV, Univ Algarve, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="Portugal:Madeira Island"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="mRNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="15-118"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5ISG0"
FT                   /db_xref="UniProt/TrEMBL:Q5ISG0"
FT                   /product="coat protein"
FT                   /protein_id="AAV74332.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGGTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 123 C; 171 G; 181 T; 0 other;

 AY660009  Length: 672  April 19, 2005 08:51  Type: N  Check: 3621  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt ggaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga