Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate H4 viral coat protein mRNA, complete cds.

ACC No: AY697863

Dated: 2004-09-26 | Length: 597 | CRC: 750503105

                !!NA_SEQUENCE 1.0
ID   AY697863   standard; mRNA; VRL; 597 BP.
XX
AC   AY697863;
XX
SV   AY697863.1
XX
DT   26-SEP-2004 (Rel. 81, Created)
DT   26-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate H4 viral coat protein mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Abou Ghanem-Sabanadzovic N., Sabanadzovic S., Castellano M.A., Boscia D.,
RA   Martelli G.P.;
RT   "Properties of a new isolate of grapevine leafroll-associated virus 2";
RL   Vitis 39(3):119-121(2000).
XX
RN   [2]
RP   1-597
RA   Abou Ghanem-Sabanadzovic N., Sabanadzovic S., Martelli G.P.;
RT   ;
RL   Submitted (26-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Istituto Agronomico Mediterraneo, Via Ceglie 9, Valenzano, BA 70010, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /db_xref="taxon:64003"
FT                   /mol_type="mRNA"
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /isolate="H4"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="viral coat protein"
FT                   /protein_id="AAU44344.1"
FT                   /translation="MELMSDENLNNLVITDATSLNGVDKKLLSAEVIKMLVQKGAPSDG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDLIFSNNFGERNIAVTEGDLKKVLDGCAPLTRF
FT                   TNKLITFGRTFTEAYIDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 176 A; 123 C; 149 G; 149 T; 0 other;

 AY697863  Length: 597  October 5, 2004 10:03  Type: N  Check: 6828  ..

       1  atggagttga tgtctgacga gaaccttaac aatctggtga taaccgacgc
      51  cactagtcta aatggtgtcg ataagaagct tctatctgcg gaagttataa
     101  aaatgttggt gcaaaagggt gctcccagcg acggtataga agtggttttc
     151  ggtctgcttc tttacgcact cgcagcaaga actacatcgc ctaaagtaca
     201  gcgcgctgat tcagacttaa tattctcaaa caatttcgga gagaggaata
     251  tagcagtgac ggagggtgac cttaaaaagg tgctcgacgg gtgtgcgcca
     301  cttactaggt tcactaacaa acttataacg ttcggtcgca ctttcactga
     351  ggcctacatc gacttttgta tcgcgtataa gcataagtta cctcaactca
     401  atgccgcagc ggaattaggg ataccagctg aagattcgta cttagctgca
     451  gattttctag gcacttgccc gaagctctca gaactgcagc aaagtagaaa
     501  gatgttcgcg agtatgtacg ctctaaaaac agaaggtgga gtggtgaata
     551  caccagtgag caatctgcgt caactgggta gaagggaagt tatgtaa