Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate TN.1 major coat protein gene, complete cds.

ACC No: AY707459

Dated: 2006-08-08 | Length: 672 | CRC: 1711975917

                
ID   AY707459; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AY707459;
XX
DT   07-SEP-2004 (Rel. 81, Created)
DT   08-AUG-2006 (Rel. 88, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate TN.1 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Khatabi B., Banihashemian S.M., Salekdeh G.H.;
RT   "Citrus tristeza virus isolate TN.1 major coat protein gene";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Khatabi B., Banihashemian S.M., Salekdeh G.H.;
RT   ;
RL   Submitted (07-AUG-2004) to the EMBL/GenBank/DDBJ databases.
RL   Proteomics, Agricultural Biotechnology Research Institute of Iran (ABRII),
RL   Mahdasht Road, Karaj, Tehran 31535-1897, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="TN.1"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran:Northern Region"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /db_xref="GOA:Q66S70"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q66S70"
FT                   /protein_id="AAU11287.1"
FT                   /translation="MDDETKKLKNKNKQTKEGDDVVAAESSFGSLNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVLNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVGQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 130 C; 166 G; 179 T; 0 other;

ay707459 Length: 672  08-AUG-2006  Type: N  Check: 926  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagc aaacgaaaga
      51  aggtgacgat gttgttgctg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata acgatgaatg acgtgcgtca gttgagtacc
     151  caacagaacg ctgctttaaa cagagacttg tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcgt tacaaagcga tgacgacact
     301  acgggcataa catacactcg ggagggtgtt gaagtggatt tgtccgacaa
     351  actttggact gacgtcgtgc ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtaccatt acttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcgggcagct
     651  tgggaaattc aacacacgtt ga