Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C257-10 clone 4 p23 (p23) gene, complete cds.

ACC No: AY750735

Dated: 2008-02-27 | Length: 633 | CRC: -109019426

                
ID   AY750735; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   AY750735;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C257-10 clone 4 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-633
RA   Iglesias N.G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C257-10"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="4"
FT                   /db_xref="taxon:12162"
FT   gene            1. .633
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L2K6"
FT                   /protein_id="AAW82207.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGMTAKAMLPDINAIDVGDNEDTSSDYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 191 A; 122 C; 162 G; 158 T; 0 other;

ay750735 Length: 633  27-FEB-2008  Type: N  Check: 1555  ..

       1  atggacgata ctagcggaca aactttcatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagcactg aagtcaaaac cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttattatcga cgccttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggggtcgagg actgaacgta
     251  agtgtaaagt caacaataca caatctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtgaaata tttaaataaa agaaaggcta gagctttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcatacc aaagaaaagc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaggaaact ccggaatatt ataagttcgg
     501  tatgactgct aaggcaatgt taccggacat caacgctata gacgttggtg
     551  ataacgagga cacttcgtcg gactacccag tgagtctgag tgtttcaggc
     601  ggagttcttc gtgaacacca cttcatctga ttg