Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C257-9 clone 5 p23 (p23) gene, complete cds.

ACC No: AY750745

Dated: 2008-02-27 | Length: 633 | CRC: 1136482714

                
ID   AY750745; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   AY750745;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C257-9 clone 5 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-633
RA   Iglesias N.G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C257-9"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="5"
FT                   /db_xref="taxon:12162"
FT   gene            1. .633
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L2J6"
FT                   /protein_id="AAW82217.1"
FT                   /translation="MDSTSGQTFISVNLSDESNTASTEVKTVSSEADRLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHEKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINVVNVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 194 A; 123 C; 157 G; 159 T; 0 other;

ay750745 Length: 633  27-FEB-2008  Type: N  Check: 9592  ..

       1  atggatagta ctagcggaca aactttcatt tccgtgaacc tttctgacga
      51  aagtaacacg gctagtactg aagttaaaac cgtaagttct gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcgttatcga tgctttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgaaaa gggttcgagg actgaacgta
     251  agtgtaaggt caacaacaca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaagtaaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg aaaagacgag actggctcgt
     451  aaacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacgtcgta aacgttggtg
     551  acaacgaaga cacttcgtcg gaatacccag taagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga ttg