Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C268-2 clone 4 p23 (p23) gene, complete cds.

ACC No: AY750747

Dated: 2008-02-27 | Length: 633 | CRC: 594766961

                
ID   AY750747; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   AY750747;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C268-2 clone 4 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-633
RA   Iglesias N.G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C268-2"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="4"
FT                   /db_xref="taxon:12162"
FT   gene            1. .633
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L2J4"
FT                   /protein_id="AAW82219.1"
FT                   /translation="MNDTSGQTFVSVNLSDESNTASTRVENVKSEADRLDFLRKMNPLI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVELAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKVMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 189 A; 125 C; 164 G; 155 T; 0 other;

ay750747 Length: 633  27-FEB-2008  Type: N  Check: 9555  ..

       1  atgaacgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcgagcacta gagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggattt tttacgtaaa atgaatccct taattattga cgctctggtg
     151  cggaaaacca attatcaggg cgctcgcttt cgtgcgagaa taataggagt
     201  atgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaaata tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt tttgtacacc aaggaaaagc
     401  aattggcggt tgaattggcc gccgaaaggg agaagacgag gttggctcgt
     451  agacacccaa tgcgttctcc agaggaaact ccggaacatt ataaattcgg
     501  tatgaccgct aaagtgatgt taccggaact caacgctgta ggcgttggtg
     551  ataacgaaga cacttcgtcg gaatacccag tgagtctgag tgtttccggt
     601  ggagttctcc gtgagcacca cttcatctga ttg