Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C268-2 clone 6 p23 (p23) gene, complete cds.

ACC No: AY750748

Dated: 2008-02-27 | Length: 633 | CRC: 323166375

                
ID   AY750748; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   AY750748;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C268-2 clone 6 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-633
RA   Iglesias N.G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C268-2"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="6"
FT                   /db_xref="taxon:12162"
FT   gene            1. .633
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:Q7T6D9"
FT                   /protein_id="AAW82220.1"
FT                   /translation="MDSTSGQTFVSVNLSDESNTASTAVRTVSSEADRLEFLRKMNPFV
FT                   IDALVRKTSYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMYTKEKQLAVNLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSDGVLREHHFI"
XX
SQ   Sequence 633 BP; 194 A; 125 C; 157 G; 157 T; 0 other;

ay750748 Length: 633  27-FEB-2008  Type: N  Check: 7  ..

       1  atggatagta ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcaagtactg cagttagaac cgtaagttcg gaagctgatc
     101  gcttggaatt tttacgaaaa atgaacccct ttgtcatcga cgctttggta
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcaaaaa taataggagt
     201  atgcgtagat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caacaataca caatctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaggaaaagc
     401  agttggcggt taatttagcc gctgaaaggg agaagacgag actagctcgt
     451  agacacccga tgcgttctcc ggaagaaact ccggaacact ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacgctgtg gacgttggtg
     551  ataacgagga tacttcgtca gagtacccag tgagtctgag tgtttctgac
     601  ggagttctcc gtgaacacca cttcatctga ttg