Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C269-6 clone 3 p23 (p23) gene, complete cds.

ACC No: AY750750

Dated: 2008-02-27 | Length: 633 | CRC: -1209938621

                
ID   AY750750; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   AY750750;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C269-6 clone 3 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-633
RA   Iglesias N.G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C269-6"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="3"
FT                   /db_xref="taxon:12162"
FT   gene            1. .633
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L2J1"
FT                   /protein_id="AAW82222.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKAVSSEADRLEFLRKMNPFI
FT                   IDALTRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VIYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 192 A; 128 C; 160 G; 153 T; 0 other;

ay750750 Length: 633  27-FEB-2008  Type: N  Check: 8014  ..

       1  atggacgata ccagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagtactg aaatcaaagc cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgaca
     151  cggaaaaata gttatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtaatata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatgaccgct aaggcaatgt taccggacat caacgctgta gacgttggtg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga ttg