Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C257-2 clone 2 coat protein (p25) gene, complete cds.

ACC No: AY750756

Dated: 2008-02-27 | Length: 672 | CRC: -1013903024

                
ID   AY750756; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AY750756;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C257-2 clone 2 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-672
RA   Robledo G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C257-2"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="2"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q3L2I5"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L2I5"
FT                   /protein_id="AAW82228.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDQDKDFHLAMMLYRLPVKSSSLQSDDDTTGVT
FT                   YTRQGVEVELSDKLWTDVVFNSKGIGNGTNALRVWGRTNDALYWAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTGLECAVYIQAKEQLLKKRGADKVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 126 C; 170 G; 178 T; 0 other;

ay750756 Length: 672  27-FEB-2008  Type: N  Check: 1555  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg acgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgacc aagacaaaga ctttcactta gctatgatgt
     251  tatatcgttt accagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg gcagggtgtt gaagtggaat tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aacggtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta ttgggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gattgactgg tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga taaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga