Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C257-9 clone 6 coat protein (p25) gene, complete cds.

ACC No: AY750761

Dated: 2008-02-27 | Length: 672 | CRC: 691444042

                
ID   AY750761; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AY750761;
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate C257-9 clone 6 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 17999168.
RA   Iglesias N.G., Gago-Zachert S.P., Robledo G., Costa N., Plata M.I.,
RA   Vera O., Grau O., Semorile L.C.;
RT   "Population structure of Citrus tristeza virus from field Argentinean
RT   isolates";
RL   Virus Genes 36(1):199-207(2008).
XX
RN   [2]
RP   1-672
RA   Robledo G.;
RT   ;
RL   Submitted (15-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Ciencia y Tecnologia, Universidad Nacional de Quilmes,
RL   Roque Saenz Pena 180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C257-9"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="6"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q3L2I0"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L2I0"
FT                   /protein_id="AAW82233.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPSLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYCLAVKSSSLKCDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALGVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 125 C; 166 G; 184 T; 0 other;

ay750761 Length: 672  27-FEB-2008  Type: N  Check: 2664  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc atctctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtattgttt agcagttaag agttcatcat taaaatgcga tgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttgg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga