Sequence of DPV Citrus tristeza virus

Citrus tristeza virus haplotype T6-31 coat protein (CP) gene, partial cds.

ACC No: AY764154

Dated: 2005-04-16 | Length: 669 | CRC: -22375736

                !!NA_SEQUENCE 1.0
ID   AY764154   standard; genomic RNA; VRL; 669 BP.
XX
AC   AY764154;
XX
SV   AY764154.1
XX
DT   31-DEC-2004 (Rel. 82, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus haplotype T6-31 coat protein (CP) gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Papic T., Santos C., Nolasco G.;
RT   "First Report of Citrus Tristeza virus (CTV) in the State Union of Serbia
RT   and Montenegro";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Papic T., Santos C., Nolasco G.;
RT   ;
RL   Submitted (27-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV-FERN, Universidade do Algarve, Campus de Gambelas, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /country="Yugoslavia"
FT                   /db_xref="taxon:12162"
FT                   /haplotype="T6-31"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolation_source="satsuma on trifoliata rootstock"
FT   gene            1. .>669
FT                   /gene="CP"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5IEC9"
FT                   /db_xref="UniProt/TrEMBL:Q5IEC9"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAW01446.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDAHYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 197 A; 123 C; 168 G; 181 T; 0 other;

 AY764154  Length: 669  April 19, 2005 08:52  Type: N  Check: 3249  ..

       1  atggacgacg aaacaaagac attgaagaac aagaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagagactta tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtttggggt agaactaacg atgctcatta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt