Sequence of DPV Citrus tristeza virus

Citrus tristeza virus haplotype 437-7 coat protein (CP) gene, partial cds.

ACC No: AY791841

Dated: 2005-04-16 | Length: 669 | CRC: 1012113896

                !!NA_SEQUENCE 1.0
ID   AY791841   standard; genomic RNA; VRL; 669 BP.
XX
AC   AY791841;
XX
SV   AY791841.1
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus haplotype 437-7 coat protein (CP) gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Cerni S., Skoric D., Krajacik M., Gatin Z., Santos C., Martins V.,
RA   Nolasco G.;
RT   "Occurrence of stem-pitting strains of Citrus tristeza virus in Croatia";
RL   Plant Dis. 89:342-342(2005).
XX
RN   [2]
RP   1-669
RA   Cerni S., Skoric D., Krajacik M., Santos C., Nolasco G.;
RT   ;
RL   Submitted (25-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ Algarve, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT                   /haplotype="437-7"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="SwO stem pitting 437"
FT                   /specific_host="Citrus sinensis cv Washington Navel"
FT   gene            1. .>669
FT                   /gene="CP"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q5C857"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAX33770.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 193 A; 125 C; 173 G; 178 T; 0 other;

 AY791841  Length: 669  April 19, 2005 08:50  Type: N  Check: 2022  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttct ttaaacttac
     101  acatcgatcc gactttgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaaa agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtagatt tgtctgacaa
     351  actttggacc gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg acgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgt