Sequence of DPV Citrus tristeza virus

Citrus tristeza virus haplotype 446-6 coat protein (CP) gene, partial cds.

ACC No: AY791842

Dated: 2005-04-16 | Length: 669 | CRC: 845518023

                !!NA_SEQUENCE 1.0
ID   AY791842   standard; genomic RNA; VRL; 669 BP.
XX
AC   AY791842;
XX
SV   AY791842.1
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus haplotype 446-6 coat protein (CP) gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Cerni S., Skoric D., Krajacik M., Gatin Z., Santos C., Martins V.,
RA   Nolasco G.;
RT   "Occurrence of stem-pitting strains of Citrus tristeza virus in Croatia";
RL   Plant Dis. 89:342-342(2005).
XX
RN   [2]
RP   1-669
RA   Cerni S., Skoric D., Krajacik M., Santos C., Nolasco G.;
RT   ;
RL   Submitted (25-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ Algarve, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT                   /haplotype="446-6"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="SwO stem pitting 446"
FT                   /specific_host="Citrus unshiu"
FT   gene            1. .>669
FT                   /gene="CP"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5C856"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAX33771.1"
FT                   /translation="MDDETKTLKNEIKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDADTTGIT
FT                   YTREGVEVDLSDKLWTGVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 188 A; 128 C; 175 G; 178 T; 0 other;

 AY791842  Length: 669  April 19, 2005 08:50  Type: N  Check: 3281  ..

       1  atggacgacg aaacaaagac attgaagaac gaaatcaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtact
     151  caacagaacg ccgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgccgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact ggcgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga cttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt