Sequence of DPV Citrus tristeza virus

Citrus tristeza virus haplotype 441-3 coat protein (CP) gene, partial cds.

ACC No: AY791843

Dated: 2005-04-16 | Length: 669 | CRC: 1663117933

                !!NA_SEQUENCE 1.0
ID   AY791843   standard; genomic RNA; VRL; 669 BP.
XX
AC   AY791843;
XX
SV   AY791843.1
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus haplotype 441-3 coat protein (CP) gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Cerni S., Skoric D., Krajacik M., Gatin Z., Santos C., Martins V.,
RA   Nolasco G.;
RT   "Occurrence of stem-pitting strains of Citrus tristeza virus in Croatia";
RL   Plant Dis. 89:342-342(2005).
XX
RN   [2]
RP   1-669
RA   Cerni S., Skoric D., Krajacik M., Santos C., Nolasco G.;
RT   ;
RL   Submitted (25-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ Algarve, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT                   /haplotype="441-3"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="SwO stem pitting 441"
FT                   /specific_host="Citrus wilsonii"
FT   gene            1. .>669
FT                   /gene="CP"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5C855"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAX33772.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAEFSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGIEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALHLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLRADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 191 A; 127 C; 175 G; 176 T; 0 other;

 AY791843  Length: 669  April 19, 2005 08:50  Type: N  Check: 9867  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagttttc tttcggttcc gtgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgcactgaa cagagacttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga tttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggtataa catatactcg ggagggtatt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg acgcccttca tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctacgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt