Sequence of DPV Mint virus 1

Mint virus 1, complete genome.

ACC No: AY792620

Dated: 2005-08-19 | Length: 15450 | CRC: 307718797

                !!NA_SEQUENCE 1.0
ID   AY792620   standard; genomic RNA; VRL; 15450 BP.
XX
AC   AY792620; AY789139; AY795609;
XX
SV   AY792620.1
XX
DT   27-JAN-2005 (Rel. 82, Created)
DT   19-AUG-2005 (Rel. 84, Last updated, Version 4)
XX
DE   Mint virus 1, complete genome.
XX
KW   .
XX
OS   Mint virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-15450
RA   Tzanetakis I.E., Postman J.D., Martin R.R.;
RT   "Characterization of a novel member of the Closteroviridae from Mentha";
RL   Phytopathology 95:1043-1048(2005).
XX
RN   [2]
RP   1-15450
RX   DOI; 10.1016/j.jviromet.2004.11.006.
RX   PUBMED; 15664053.
RA   Tzanetakis I.E., Keller K.E., Martin R.R.;
RT   "The use of reverse transcriptase for efficient first- and second-strand
RT   cDNA synthesis from single- and double-stranded RNA templates";
RL   J. Virol. Methods 124(1-2):73-77(2005).
XX
RN   [3]
RP   1-15450
RA   Tzanetakis I.E.;
RT   ;
RL   Submitted (26-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Dept. of Botany and Plant Pathology, Oregon State University, 3420 Orchard
RL   Ave, Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .15450
FT                   /db_xref="taxon:300740"
FT                   /mol_type="genomic RNA"
FT                   /organism="Mint virus 1"
FT                   /isolate="NCGR MEN 454.004"
FT   5'UTR           1. .181
FT   CDS             182. .7717
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G7G7"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="UniProt/TrEMBL:Q5G7G7"
FT                   /note="p282"
FT                   /product="polyprotein 1a"
FT                   /protein_id="AAW32892.1"
FT                   /translation="MAVCVFAVPIFSSGNLSVPRLSFEIAPATAVPGLSQLTFSMSDCT
FT                   GKEIVLSTVPSTGVAPSCTPSTLAKRRSILRRPTHLPKGECTFYCGLTEGTAHRSPRRD
FT                   IGKSFPCLFVASGGICHKVPFTPENVNTSCLFVRQDGRCSKVPCPTARRSDAIVGKGGF
FT                   SLTRQFHNRNKTKTMIINLHDGDRFVTDRCTLLLSGGKPVEGTTCGGRRISLFSKPFTA
FT                   AKCGKGGPRTPRRISHRFRTQSPNEINTLCVDSIVSLFEPLPVVKPADSITMFFGEFET
FT                   VIPLAPERASVVFSQPEPESVEEVVPEVHRNAPTARSRRHRGRGINTPAPTRNFKLSAE
FT                   KVKNSFVSVDGVTVPLGGKVGHHYKFDGGYDEFRTAVTDYLSFYSPLRDDFFSSVECGG
FT                   VNYNFTPVGARRVAVVRSDGRVVARLPASRDFAEVYRMQTTKSFSGRLVSNFHSPNGLC
FT                   YLNHVWFLCLISGTSFLRARKYFGRLGAFPGVESFFSLLCNFFSYHAVRIQIRGYFTST
FT                   GIFHCDNVRGNLFNHRYQRLRSARVGGENGEVPNEMVNAITPLEKERLINQLIETSRGH
FT                   KDSLLLKKMEVDLVEHVARLKRAQLEKPERKVPFHLTEQQQSHIVRDYPQYDILFTHST
FT                   HSDHPMAAASRLLENFSLSDKCGDDFSDIGGCPLHHYRNSKLKKVHVCRPILDSKDAQR
FT                   RIIRNAEFRKPQKHASKDVEENLYVNSLHTSCSYTISECRHTTPYMMMVQVYDVPLSTT
FT                   CQSMINKGADVCYLTMITPGEILDRRECFHHDVIGCDISIDIHRDSIVYKFGSSCYTHD
FT                   LSLVTEYMKTPVYVLGGYLFSIEMVEVRCGVNYYVITKSDVSPTIDCSKTLRYPRCCLE
FT                   LVKVKLPRFCKKTRKCLPGIDLIYVDRKFVERVYEYVVGNCSVINSKTFEWTWNFVKTS
FT                   KSRVVISGKIIHRDVSINLDNLEQFVVVMLAAGVRSRMSSEYLAKNVSMFAGDASFSEI
FT                   VRFTISEKIKDLKRNLNRTICDSFRKLFADALLMEFLDIDDSLEYLDAFSETVVHISLR
FT                   GFGSVPSNEPEIMIADKSLNDTVDSVVSEQVRKMYVPPHVKSRDGNNRPKGGLRAGSPV
FT                   GVYEKVLNILRTLSKNFFCIGSSFAFHVRAIVSKIFPFERLPNLVKVIDLLVDQVSVFK
FT                   PSAFFELVSRACAIFSEKRAHASEFFYDYIVARIPVAPGSVKGFLTSCANSAMSLSELG
FT                   GKFSLVFQPLVKFFDSFKHWSIFDGSYVFCFESAAIVCKRLIFDIRKVLEGRMTWKSLL
FT                   SRTLFDIVFEFSLNALLSCKLGPADTIKKDLFIRSVSSVVSDGVLDGYDMSVMSYVKLS
FT                   ALVPMLARKFIVSFFSDECDPYVPLMRYAASDFSAYEYLALVFKNEVQGHVELIRDSVT
FT                   DCLRAVGGKAAARTEAVLDLVEQRLELISRRMVKNSIDEVTKRLSDVAACKRISSSCSS
FT                   ISGAVIATSNRASRFVKRVMNRRCSDPGTDVYYSAASDSNDESTSAKGGLAGGNSCRSF
FT                   VGVITALLALLRGLGKFAYDEVYFLIVNQLLRPLNLAEFISTLKEFKIDRLRRRNLNRI
FT                   PVTFSARQFGQLVFVRATEHCHTVKSVIDRVGVAGMFKVAFLDFMDRFGSVEYLLFELP
FT                   IYLAELYMYYNHPLTFSVRVVSYLISFTFQPVYTCDIITTVANGVVVNTERSVVEEIVP
FT                   DEYDSDSDFSMGLGEVDYGNEREIVVGGLAGGARTNFNAISLIFRFIRFIAKLVFTSRF
FT                   INGFLRYVKSSFISSVINRRENTVVSRLISSLVLIDDPASCFIPVVRAAYNRRGHRTYP
FT                   VVRKVVEPLLFLENLFSKRIYDEEKSETTSVSYRRVEVETRLPSPIVRGEIITSVENLS
FT                   NLRDELDVLFKNAIPTNSGNESDPVFDTPGEGATGDLRQDEVRAEECDVPTNAVAVDEI
FT                   ERADLTPFVAQATEEGKENERMGIDSGRIIIPKLRKGNAACCKFLNLQNISTTVPTFSI
FT                   SNSRSFPMCSNAIREFYYAQEMKIFSIHSKLLGYYEELRAVDFNRKAATCSQDVDLSMY
FT                   DPTSNTVHCGDGTNRGLSKFSSHQFAFTSAGLKPFDLKEIQKQGTHALFHEQTHFLAAN
FT                   EFLKGFESHSTAVFSNEDVTIKLFEAPPGGGKTTTLIELYIERREKHKTFIVTANKNSQ
FT                   VEISDRVARKLADSEVPFDKRSVMTMDSYLMNRCGETCDLLFMDECFMVHAGQVLGIIN
FT                   KTMCKVAILFGDSKQIHYIERDEFVSTVYHDIDSFIEPFCRMYGEISYRCPWDVCEWLS
FT                   KLYKRQIKSNNTSSIGKQSVSVVNIESVEDVPFVQSIKYLTYTQSEKAELRRKFEKFSS
FT                   EPSVNTVHEAQGETFKNVYLVRTKFQEDAPFVSENHVIVALSRHVESLHYYVISARCYD
FT                   DTASAISTMLDISEKYRTMPRSFETSSISMEVSGESPDDSRCKALSAPHDSINSFLNEI
FT                   LEGSNSINFGDLSAEMSSQPFDCGVDGITVREASDEKVYDDHTNRRV"
FT   mat_peptide     182. .1810
FT                   /product="protease"
FT   mat_peptide     1811. .7714
FT                   /product="methyltransferase/helicase"
FT   CDS             <7716. .9095
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G7G6"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q5G7G6"
FT                   /note="RdRp; p52; putatively expressed by a +1 ribosomal
FT                   frameshift with polyprotein 1a"
FT                   /product="polymerase"
FT                   /protein_id="AAW32893.1"
FT                   /translation="SLIRSQAIPQRTPSLQENLYSFESRNFNFLTCERFASPSVFGKAM
FT                   ARNLVERCFGDCDFLSFKNSPICLSSGALLKWLAKRDSSQIKSLQSELNRPLDLETSIH
FT                   YFKLMVKRDAKVKLDSSCLTKHSAAQNIMFHAKAVNALFSPCFDEFKNRFMSCLKKHIV
FT                   FFTEMDNRLFARVVNGLVGSDDSDLHVGEVDFSKFDKSQDVFIKEFEREIYSLLGFDSE
FT                   LLQLWMEGEYAAKATSLDGKLSFDVKNQRRSGASNTWIGNSVVTLGVLSMYYRVDELSA
FT                   LFVSGDDSLMYSRSPIRNHAEAICIETGFETKFLSPSVPYFCSKFVVHCGHKTYFVPDP
FT                   FKLMVKLGAVRNELTDKDLFEVFTSFRDLTKDFDDERVLVKLNYLLESKYGKVSAFALP
FT                   ALRSIHCLASNFSSFVKLFDKSCGWVVVPKINSYFKKLISLGAYHEKFVTPFGEQYFIS
FT                   W"
FT   CDS             9106. .9306
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5G7G5"
FT                   /product="p7"
FT                   /protein_id="AAW32894.1"
FT                   /translation="MDCTLRAYFYLLLGWIIVCFSFTLGFVVYKLVRTCSNVYGDIIDT
FT                   SVVGTSRRIDIENRGNSSARV"
FT   misc_feature    9112. .9114
FT                   /note="cysteine which may be used for dimerization; binding
FT                   site"
FT   misc_feature    9124. .9192
FT                   /note="Region: transmembrane helix"
FT   CDS             9309. .11123
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G7G4"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="UniProt/TrEMBL:Q5G7G4"
FT                   /note="p67"
FT                   /product="HSP 70h"
FT                   /protein_id="AAW32895.1"
FT                   /translation="MVIFGLDFGTTFSTLSVLKANEVFVLKQNDSPYIPTYLFFYKNSR
FT                   EVAYGYDAERLLHSKGSEGGFFRDLKRWIGCTERNYASYLEKLAPSYTTSIDSSIDNCD
FT                   FRIPMLNCFNSSCDMKLSLPDLVASFVRCIVTDGEKSFSVKCSGVVCSVPAAFTSTQRN
FT                   FIMECVSLSGFHCSHIINEPSAAAFSAFRKLSPSERFVMVYDFGGGTFDVSAVSVRNST
FT                   FVVKASGGDMNLGGRDVDRALLESIHEKAGVKHVDYTVDISSIKEKVSQALSSFVYDLP
FT                   VGKEFVSVLVTVEDVSKVVVPFIERTVKIMHSVYKSFIESSLDVSTMNHDRKCSVVTVG
FT                   GSSYLPGLKNVIEAIPFVNRVVEVPDARSAVSAGCALYSLCLSSNSSMLLVDCATNTLT
FT                   TPSYTCETIVVVPKGAPIPFSGKRKIFLSKATRSKKFYAALFEGEYQKCALNELVYSHN
FT                   VPLSELGVTSDLPRSLPMTLEVQISSVGTVKFDIITDGDRRYTVGKDRPYDFSSRNAPS
FT                   RNVVRMSDSLQRRTSSILYSSRSERVRSSIREDVRQKIYSPESELAPNDVVVQCGLNDE
FT                   EKSDCAKYLDSSVGKIVRGASILKLDLD"
FT   CDS             11126. .12745
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProt/TrEMBL:Q5G7G3"
FT                   /note="p62"
FT                   /product="CPh"
FT                   /protein_id="AAW32896.1"
FT                   /translation="MVNFGRRYYGELFCRFYGSQHWEEYLNKASSLPLQRQSEDYRFDN
FT                   GEVLSVNELNSTQPGSCEREFVILLTSEIIYKWCSVCGLDVKMGMSTVNTGRDLNFSKD
FT                   PFISVDVKSTGCKFPMNDIKTFLGTKGDDIELAEHCWSLSNSCGEMIDPSDISRFKAIT
FT                   FRSDSESKSEAVTSSRVIDYLSHCLSIVDMVSLPSQKGEKRMLDKVFEKYLTYLGSSTL
FT                   VTNGCCDNPLMKGVVFDFVRENAAYLSTYANNIKNFSIFSATYMPVIEDTWHFKWNETP
FT                   PDFRLLFDFTLTDLTDKSLPLLNVNDMQVVLGSQVKYVENVLMDVDILSMRDYIYALMK
FT                   KSNSWADESTLWAAFHCYYGTYRTAISRVVSRPLLYVPPPQLTTRVIDFSTVENLFDTL
FT                   QKRKPDTNIRRQFCGKLGVEAIACFKALKLSFPKICTLNVPLEYGYLNIDYYKHIPGRN
FT                   LSDEERLILCNIKDSVNEMCLNRALSTEKRNAQRHPKLLPNKNSFRDRDSEHKRTLSVS
FT                   KNGLDALRRRLYCSTGGTERRL"
FT   CDS             12681. .13337
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G7G2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q5G7G2"
FT                   /note="p24"
FT                   /product="CPm"
FT                   /protein_id="AAW32897.1"
FT                   /translation="MALTLSDADYIAQPAALRDASSEIVEKFSEGLDVNSITHSTDSAF
FT                   SKKEAEEAIPGVLSRLRELTKADSKQDIVHFMMLMCRAQIISTSMKVKYTGSYSYTVGG
FT                   MGFTIKDADIFPHIIHMLAKYKKPNPLRALFTTFETPFIHFSKIRPDLAETRSACRRGT
FT                   PTGYGYLSADFLTGSSPSLNDRERAIVNRSSEHAINRANLTGASKELVSLYDIGA"
FT   CDS             13477. .14082
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G7G1"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q5G7G1"
FT                   /note="p22"
FT                   /product="coat protein"
FT                   /protein_id="AAV58835.1"
FT                   /translation="MVDTAGKLAVIDAFNVEDERIISSVSDLAEIRQKFEKFVTDKLQG
FT                   DLKDLDLHLGLILVAFAIKTTSRQAVKGDAEFVNYTLSGHVSTATEKDITEFLNSLPQL
FT                   KDRKNKARVFCRSFAKEYIKTCRSHANSLPKQTRAIKLGIPDRYHYLQADFVTDCSELT
FT                   DEEQAVLLHGRNHAVAPINSAATPIVTNLYELGGGKRN"
FT   CDS             14082. .14675
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5G7G0"
FT                   /note="p22"
FT                   /product="unknown"
FT                   /protein_id="AAW32898.1"
FT                   /translation="MSEVSFSIRPIADGDTNTIVIIRDKFGHSVLNFKSPAGDDSLALV
FT                   EESCIISRSDFESVASCDDSFFLAGLNSLEDALNNFVLHSPRSLTATSESLSSLEYIDF
FT                   VLDPIMLGIIFRFNLKRRINNDSVSLFRDSLISLNGGWYNGTLYDDMFHYLSNFFKQKK
FT                   GFTIHSFELIKQNEVVFPSRVLRVSGDRGHQPID"
FT   CDS             14608. .15168
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5G7F9"
FT                   /note="p22"
FT                   /product="putative silencing supressor"
FT                   /protein_id="AAW32899.1"
FT                   /translation="MKLYFRVAYYESLVTEATNLLTRVRNRDENHDRAALNKWILDFTD
FT                   LAARVQCIKSDVNDAKREESAHDINTKVALLQTFEQRLAEARDVLRLIVVKDQLNLESK
FT                   ELLAFFVKYFTNITPTSFDHAIEYSVRQLVSAVLLHLSSESGLDISANTFRQNVLLRSN
FT                   NKVIVEWTRRLGYTKEQLADMCS"
FT   3'UTR           15169. .15450
XX
SQ   Sequence 15450 BP; 3890 A; 3508 C; 3609 G; 4443 T; 0 other;

 AY792620  Length: 15450  August 30, 2005 08:42  Type: N  Check: 73  ..

       1  gtttctttgc aaaccttttt gtgtgcccgc tttcacaagt ctgtacacat
      51  tcttcctctc acgtcccctg cgtgtttggt tttttcgctg aacttcgctc
     101  tctctctctc cttcttcttt ctctctgctc actgtccctg ctcctttcct
     151  ctcaccacct ttccccgacc actcgatcct catggccgtt tgcgtcttcg
     201  ccgtcccgat cttttcatcc ggcaacctgt cggttccacg tctctcattt
     251  gagatcgctc cagccaccgc cgtccccggt ctctcgcagc tcactttttc
     301  aatgagcgac tgcactggga aagagattgt gctttccacc gtcccatcca
     351  ccggggttgc ccctagttgc accccgtcaa ctcttgctaa gcgcaggagc
     401  atccttcgac gtcccaccca tcttcctaag ggtgagtgca ctttctactg
     451  tggtcttact gaagggaccg cgcaccgcag tccgaggcgg gatattggta
     501  aatccttccc gtgtttgttt gtcgcatctg gcggcatttg tcacaaggtc
     551  ccgttcaccc ccgagaatgt gaacacgagt tgcttgttcg tccgacagga
     601  cggccgctgc tccaaagtcc cgtgccctac ggcacgacgt tctgacgcaa
     651  tcgtcggtaa gggcggtttc tcactcactc gacagttcca taaccgaaat
     701  aaaactaaaa caatgatcat taacctccac gacggtgatc gttttgttac
     751  tgacaggtgc acccttttac tgtcaggtgg taaaccggtc gaaggcacga
     801  catgcggtgg gcgccgtatt tcgctcttct ctaagccctt cacagccgct
     851  aagtgcggga aaggtggacc gcgcaccccg cgtcgcatct ctcatcgctt
     901  ccgcactcag agcccgaatg aaatcaacac tttgtgtgtt gattctatcg
     951  tgtcgctctt tgagccacta ccggttgtca aaccagccga ttcgatcacc
    1001  atgttttttg gtgaatttga aacagttatt ccactggctc cggagcgcgc
    1051  gtcggtggtt ttctctcaac cggagcctga atcggttgaa gaggtggtac
    1101  ccgaggttca ccgcaatgca ccgactgcac ggtctcgccg ccaccgcggt
    1151  cgtggtatta acactcccgc gccgacacga aattttaaac tttctgcgga
    1201  gaaagttaag aattcgtttg tttcggtcga cggggtgact gtacctttag
    1251  gtggtaaagt gggccaccac tataagttcg atggtggtta cgatgaattt
    1301  cgcactgccg tcaccgacta cctttccttt tactcccctt tacgagatga
    1351  tttcttctcg tcggttgagt gtggtggggt caactataac ttcacacccg
    1401  ttggtgcacg ccgcgtggcc gttgtccgct ccgatggacg cgtcgttgcg
    1451  cgcttacccg catcgcgcga ctttgcagaa gtttatcgta tgcaaactac
    1501  gaaatccttc tccggtcggt tggtctccaa ttttcactct cccaacgggt
    1551  tgtgttacct caaccacgtt tggttcctgt gcctaatctc aggtacgtca
    1601  tttctacgcg ctaggaaata cttcggacgt ttgggtgctt ttccgggtgt
    1651  cgaaagtttc ttttcgctct tgtgcaactt cttctcgtac cacgccgtta
    1701  gaattcaaat acgcggctac ttcacttcta cggggatctt tcactgcgac
    1751  aacgttcgtg gtaacctgtt taaccacagg tatcaacggc tccgttcagc
    1801  gcgtgtgggc ggtgagaatg gcgaagttcc gaatgaaatg gtgaacgcca
    1851  tcacaccgct tgagaaagag cggctcatca accaactcat cgagacgtcg
    1901  cgagggcaca aagactcgtt acttctcaag aagatggaag tggatttggt
    1951  tgaacatgtt gcacgtctta aacgcgctca attggaaaaa cccgagagga
    2001  aggtcccttt tcacttaacc gaacaacagc aatctcacat agtgcgtgac
    2051  taccctcaat acgacatcct attcacccat tctacgcact cggaccaccc
    2101  gatggctgct gctagcagac ttcttgaaaa tttttctcta tccgacaagt
    2151  gtggtgacga tttttcggac attggtggtt gccctttaca ccactatcgc
    2201  aattctaagt taaagaaagt tcacgtctgc cgccccatcc ttgatagcaa
    2251  ggatgctcag cgtcgtataa ttcgcaacgc cgagtttcga aaaccccaaa
    2301  agcatgcttc gaaagatgtt gaggagaatt tgtacgtcaa ctcgctgcat
    2351  actagttgct cgtatacgat ctcagaatgt cgacacacga caccgtatat
    2401  gatgatggtg caggtgtacg atgttccgct aagcactacg tgccagtcca
    2451  tgataaacaa aggtgctgac gtgtgttatc tgaccatgat tactcccggg
    2501  gagatacttg atcgacgtga gtgttttcac catgatgtca taggatgtga
    2551  tatttctatc gatattcatc gcgattccat cgtttacaag tttgggtcat
    2601  cgtgctacac tcacgatctc agtctggtca ctgagtacat gaaaactcct
    2651  gtttatgtcc tcggtggcta cctcttttcg atcgaaatgg ttgaagttag
    2701  gtgtggtgtt aattactatg tgatcaccaa atccgatgtc agccccacca
    2751  tcgattgtag taagacacta aggtacccta ggtgttgcct cgagcttgtt
    2801  aaggttaagc ttccgaggtt ctgcaagaag actcgtaagt gcctgcccgg
    2851  gatagatctt atttacgtcg acaggaaatt tgtcgagcgt gtttatgagt
    2901  acgtggttgg taattgtagt gtaatcaact ctaagacctt cgagtggacg
    2951  tggaattttg ttaaaaccag caaatcgcgc gtggttataa gtggtaaaat
    3001  catacaccgc gatgtttcca ttaatctcga taacctcgag cagttcgtgg
    3051  ttgtcatgtt agccgcgggt gttcgttctc gaatgtcatc cgagtacctt
    3101  gcgaaaaatg tcagcatgtt cgcgggagac gcatctttct cagagatcgt
    3151  acgtttcacg atcagtgaga aaattaaaga tttgaaaaga aatttaaatc
    3201  ggactatctg tgactcgttc aggaagttgt tcgctgacgc tctccttatg
    3251  gagttcctcg acatcgatga ttctctagag tatttggacg cgttttcaga
    3301  gactgtagtc cacatttctc tgcgaggttt cggttctgtt cccagcaacg
    3351  aacctgagat catgatcgct gataaaagct tgaatgacac cgttgattcg
    3401  gttgtgtctg agcaagttcg gaagatgtac gtccctccgc atgtcaaaag
    3451  tagggatggg aacaatagac ctaagggcgg gctacgcgct gggtctcctg
    3501  ttggggttta cgagaaggtg ttgaatatcc tgcgcacgct gtcgaagaat
    3551  ttcttctgta tcgggagttc tttcgcgttt cacgtgcgtg caatcgtttc
    3601  aaaaatcttt cctttcgaga ggttgccaaa cctcgtaaag gtcatcgact
    3651  tgctcgtcga tcaggtatct gtatttaaac cgagtgcctt ctttgaactc
    3701  gtttcgagag cgtgcgctat ttttagtgag aaacgagcac acgcgtctga
    3751  attcttctat gactatatcg tcgcgagaat tcccgtcgct cctggatctg
    3801  tcaagggatt tctaacctcc tgcgcgaaca gtgcgatgag tttaagtgaa
    3851  cttggtggga agttctcatt agtctttcaa cctctcgtta aattcttcga
    3901  ctcgtttaag cactggtcta tttttgacgg ttcatatgtt ttctgtttcg
    3951  aaagtgccgc tattgtttgt aagcgactca ttttcgacat taggaaagta
    4001  ctcgaagggc gaatgacgtg gaaatcactt ctatcgcgca ctttgttcga
    4051  catcgtattc gaattcagtc tcaacgctct cctgtcatgt aagttaggac
    4101  cagcagacac tatcaagaaa gatctgttca ttcgatctgt ctcgagtgtt
    4151  gtgtccgacg gtgtccttga cggttatgat atgtcggtca tgagttacgt
    4201  taaacttagc gccctcgttc cgatgctcgc caggaaattc atcgtcagtt
    4251  tcttttctga cgaatgtgat ccttacgtac ctttgatgcg ctatgctgcg
    4301  agtgacttca gcgcgtacga gtaccttgcg ctcgttttta aaaatgaagt
    4351  gcaaggtcat gtcgaactga tacgagattc cgtcaccgac tgcctgcgcg
    4401  cggttggggg taaagccgcg gctcgcactg aggctgtgct cgatttggtc
    4451  gaacaacggt tggagttaat ctcacggcgg atggttaaaa actcgatcga
    4501  tgaggttact aaacgcctct cggacgtcgc tgcatgtaag cgaatttcga
    4551  gttcttgtag ctctatctcg ggtgccgtga tcgctacgtc taaccgcgct
    4601  tcgcgcttcg tgaaacgtgt tatgaatcgt aggtgctcgg atcccggcac
    4651  agatgtttat tactccgctg ctagcgatag caacgatgaa tcgactagcg
    4701  cgaaaggcgg gttagccggt ggtaatagtt gcagaagttt tgttggtgta
    4751  ataaccgctc ttctcgctct cttaaggggt cttgggaagt tcgcctacga
    4801  tgaagtttac tttctcatcg tgaaccaatt actgcggccg ttgaatcttg
    4851  ctgaattcat ttcaacgttg aaagagttca agatcgacag actccgtcgg
    4901  cggaacctta accgtattcc agtgacgttc agcgctcgcc aattcggtca
    4951  actcgttttc gttcgagcga ccgaacactg tcacaccgtg aagagtgtga
    5001  ttgatcgagt aggtgtggcg ggaatgttta aagttgcatt ccttgatttt
    5051  atggatcgat ttggttcggt ggaatattta ctattcgagc tacctattta
    5101  tttagctgag ttgtatatgt actacaatca cccactcact ttctctgtac
    5151  gcgtcgtgtc gtatttgatc tcctttacat ttcaacccgt gtacacttgt
    5201  gatataatca ctactgttgc gaatggagtt gtggtcaaca ccgagcgatc
    5251  ggttgtcgaa gagatcgtac ctgatgaata cgacagcgac agtgactttt
    5301  caatgggttt gggtgaagtg gattatggga atgaaaggga aattgtagta
    5351  ggcggactcg ctggtggtgc gcgtaccaat tttaacgcta tctccttaat
    5401  tttccgtttc atccggttca tcgctaaact cgtcttcacc tcgagattta
    5451  tcaacgggtt ccttcgctac gtcaaatcat cgttcatttc gagcgtgatc
    5501  aatcggcggg agaatactgt tgtctcgcgg ttgatttcct cgttggtttt
    5551  gatcgacgac cctgctagtt gtttcatacc tgttgttagg gctgcttata
    5601  accggcgagg tcaccgcacc tatccagtgg tacgaaaagt cgtcgaacct
    5651  ttgttgtttc ttgagaatct tttttcaaaa agaatatatg atgaggaaaa
    5701  gtctgaaacc acgtctgtgt cgtaccgcag agttgaagtg gagacacgac
    5751  tcccgtcacc aatagtgagg ggtgaaatta ttacctccgt tgaaaactta
    5801  tcgaatttac gcgatgagct cgacgtccta tttaaaaacg ccattccgac
    5851  gaattctgga aacgagtcgg atcccgtttt cgacacacca ggtgaaggtg
    5901  caaccggtga tcttcgtcag gacgaagtgc gcgccgagga atgtgatgtc
    5951  ccgactaatg ctgtcgctgt tgacgagatc gagagggcgg atctaacacc
    6001  attcgtcgct caggccactg aggaaggtaa ggagaatgag cgaatgggta
    6051  ttgattcggg tcgtatcatt attcccaaac tgaggaaggg taacgcagcg
    6101  tgctgcaaat tccttaacct tcagaatata agcacgactg tcccgacttt
    6151  ttctattagt aactcgcgtt ctttcccgat gtgttccaat gcgatacgcg
    6201  aattctatta cgctcaggag atgaagattt tttctattca ttctaaatta
    6251  ttgggttact atgaagaatt gcgcgctgtt gattttaaca ggaaagctgc
    6301  gacctgttct caggacgtcg atctttcgat gtacgatccc acctctaata
    6351  cagttcactg cggcgacggg accaaccgtg gtttgagtaa attctcgagt
    6401  caccaattcg ctttcacgag cgctggtctt aaacccttcg atctgaaaga
    6451  gatacaaaaa cagggaacgc acgctctttt ccatgaacag acgcatttct
    6501  tagctgctaa tgagttcctg aaaggattcg agtctcactc aacagctgtt
    6551  ttctcgaacg aagatgtgac gataaagctc ttcgaagccc cgcctggagg
    6601  gggtaaaact actacactga tagagttgta catcgaaagg cgtgaaaaac
    6651  acaaaacttt cattgtcacc gctaataaga actctcaggt tgaaatatct
    6701  gaccgtgtcg ctcgtaaact ggccgattcg gaggttcctt tcgacaaacg
    6751  aagtgtcatg acgatggatt cttacctcat gaataggtgc ggcgagacct
    6801  gcgatcttct ctttatggat gagtgtttta tggttcacgc tggccaggtg
    6851  cttggtatta ttaacaagac tatgtgcaaa gttgcgattc tcttcggtga
    6901  ctcgaaacaa attcactaca tcgaaagaga tgaattcgtt agcactgtct
    6951  atcacgacat cgactctttc attgaacctt tctgcaggat gtacggggaa
    7001  atctcgtatc gttgcccgtg ggatgtttgc gaatggttgt ctaagctgta
    7051  caaacggcag attaaatcga ataacacttc atcaatcggc aaacagtctg
    7101  ttagcgtagt caacatagag tcggtcgaag atgttccatt tgtgcagtcc
    7151  attaagtatc taacttacac gcagagtgaa aaagctgaat tgcgtcgaaa
    7201  gttcgaaaaa ttttcatcag agccgtctgt gaacactgta cacgaagcgc
    7251  aaggtgaaac ttttaagaat gtttaccttg tgaggactaa gttccaggaa
    7301  gatgcaccgt ttgttagcga aaaccacgta atagtggcac tttcgaggca
    7351  cgtcgagtcg ctccactact acgtaatcag cgccagatgt tatgatgaca
    7401  cagcgtctgc catatcaacc atgttggata taagtgaaaa atatcgcacg
    7451  atgcctagga gcttcgaaac atctagcatt tcgatggaag tatcaggtga
    7501  aagccccgat gacagcaggt gcaaagctct ctccgcccct cacgattcta
    7551  ttaactcatt tttgaatgag atcttggagg gttcgaattc cataaacttt
    7601  ggtgatttat ctgctgaaat gtcttcgcaa cctttcgatt gcggtgttga
    7651  tggcataact gttagggagg cctctgacga aaaggtctac gacgatcata
    7701  ctaatcggcg cgtttagcct tattaggtct caagcgatac ctcaaaggac
    7751  tccctctctc caggagaacc tgtattcgtt cgaatcgagg aattttaatt
    7801  tcctcacttg cgagcgtttt gcgtctccgt cggtatttgg gaaagcgatg
    7851  gctcgcaatc tcgtcgagag atgtttcggg gattgtgact tcctcagttt
    7901  taagaattcc ccgatatgtc tttcttcggg cgcccttctc aagtggttgg
    7951  ctaagaggga ttcgtctcaa atcaagtcgt tacaatctga acttaacaga
    8001  ccactcgacc ttgagacttc tatacattac tttaaactaa tggtgaaaag
    8051  ggatgcaaaa gttaagcttg attcatcttg tttaactaaa cactcggcag
    8101  cgcagaatat catgtttcac gctaaggctg tgaatgcttt attttcaccc
    8151  tgctttgatg aattcaagaa tcgattcatg tcgtgcctta agaagcatat
    8201  cgtgttcttt accgagatgg acaataggct tttcgccaga gttgttaacg
    8251  gtcttgtcgg ttctgacgac tcagacctac atgtgggaga ggtagacttc
    8301  tcgaagttcg ataagtctca agacgttttt attaaggagt tcgaaagaga
    8351  gatttactct ctcctcggtt tcgattccga gttacttcag ttatggatgg
    8401  aaggtgaata cgcggctaaa gcgacttctc ttgatggtaa attatctttt
    8451  gacgtcaaga atcagcgacg atcaggagct tccaacactt ggattggtaa
    8501  ctctgtcgtc actttaggtg tgctcagcat gtactaccgc gtcgacgaac
    8551  tgagcgctct ttttgttagc ggtgatgatt cgcttatgta ttcccgtagt
    8601  ccgattcgta accacgctga agcgatctgt atcgaaactg gttttgagac
    8651  taagtttctt tcaccgagcg ttccttactt ctgttcgaag tttgtggttc
    8701  actgcggtca caagacctac tttgtcccag accccttcaa actaatggtt
    8751  aaactcgggg cggtgcgaaa cgaacttaca gacaaagatt tgttcgaagt
    8801  gtttacctct tttcgagatt tgacgaaaga ttttgacgac gaacgtgttc
    8851  tagttaagtt gaattatttg ctcgaatcga aatatgggaa agtttcagcg
    8901  tttgctctgc ctgcgctgcg ttccattcat tgtttggcgt ctaatttctc
    8951  gtctttcgtt aaactgttcg ataaaagttg tggttgggtc gtcgtgccga
    9001  agatcaattc gtattttaag aaactcatct ctttgggagc ctaccacgag
    9051  aagtttgtca ctccttttgg ggagcagtac tttatttcgt ggtgaaaacc
    9101  aattaatgga ttgtacgttg cgtgcgtact tctacttgct ccttggttgg
    9151  attatcgtct gtttcagttt cactttgggt tttgttgtat acaaactcgt
    9201  gcgaacttgc tcgaacgtct acggtgatat aatcgacact tctgttgttg
    9251  gaacctcgcg ccgaattgac attgaaaatc gtggtaactc gtctgccaga
    9301  gtctgaatat ggtcattttc ggtctcgact ttggaactac tttttcaaca
    9351  ctctctgtcc ttaaggcgaa tgaggtgttc gttcttaagc agaatgactc
    9401  tccgtatata cccacttatc ttttctttta taagaattct cgcgaagtgg
    9451  catacggata cgacgcggaa cgtcttcttc actcaaaagg atcggaaggg
    9501  ggtttctttc gcgatctcaa acgctggatc ggttgcacgg aacgcaatta
    9551  cgcgtcctac cttgagaagc tggctccctc gtacaccacg tcgatcgact
    9601  cttcaataga taattgtgat ttcagaattc cgatgttgaa ttgttttaac
    9651  tcgtcttgcg atatgaagct gtcgctaccc gatttggtgg ccagcttcgt
    9701  acggtgcatt gtgacggatg gagagaaatc tttcagcgtt aagtgcagcg
    9751  gggttgtgtg ttcagtaccc gctgctttca cctcgactca gaggaatttc
    9801  attatggaat gcgtttcact gagtggtttt cactgttcgc acatcatcaa
    9851  tgaaccttcg gctgctgctt tttccgcttt tcggaaattg tcacctagcg
    9901  agaggttcgt tatggtttac gatttcggcg ggggtacatt tgatgtctcg
    9951  gctgtctctg ttagaaacag cactttcgtg gttaaagcgt cagggggtga
   10001  tatgaacctc ggcggtcgcg atgtagatag ggcgctactc gagtcgatac
   10051  acgagaaagc gggtgttaag cacgtagact ataccgttga catctcgtcc
   10101  atcaaggaga aggtctctca agctcttagt tcatttgtgt atgatctacc
   10151  agttgggaaa gagttcgtga gtgtcctagt cactgttgag gatgtatcga
   10201  aggtcgtggt accttttatt gaacgtactg taaagatcat gcatagtgtt
   10251  tacaaaagtt tcattgagtc ttcactcgat gtatctacta tgaatcacga
   10301  tcgcaaatgc agcgttgtca cggttggagg ttcctcgtat ttgcccggtc
   10351  tcaagaacgt tattgaagca ataccgttcg tgaacagagt tgttgaggtt
   10401  ccagacgctc gttcagccgt ttcagctggg tgtgcgctat actctctttg
   10451  cctcagtagc aactcgtcga tgcttctcgt tgattgtgct accaacactt
   10501  tgaccacacc ctcttacact tgcgaaacga tagtcgtggt gcctaaaggt
   10551  gctccgattc ctttctcggg gaagagaaaa atttttctct ctaaggctac
   10601  tcgcagtaag aaattctacg ccgccttatt cgaaggggaa taccaaaagt
   10651  gtgcattaaa tgaactcgtt tactcgcaca acgtaccgtt gagtgaattg
   10701  ggtgtgacct ctgatttacc gaggagtcta ccaatgactc tcgaggtaca
   10751  aataagcagt gtggggactg taaagttcga tattatcact gacggtgaca
   10801  ggcgttacac tgtgggtaaa gatcgacctt atgacttctc cagtagaaat
   10851  gctccttcaa gaaacgtcgt gcgaatgtct gattcgttac agcgaaggac
   10901  gtcgtccatc ctatactcgt cacgcagtga aagagtacgt tctagtattc
   10951  gagaagacgt tcgtcaaaaa atatattctc ccgagtccga attagcgccg
   11001  aacgacgttg tggttcagtg cggtttaaac gacgaggaaa agagtgactg
   11051  tgcgaaatat ttggatagtt cggttggaaa aattgtgcga ggtgccagca
   11101  ttctgaaact cgacctagat tgatcatggt gaacttcggt aggaggtact
   11151  atggtgaatt gttctgccgt ttctatgggt cgcaacactg ggaagagtac
   11201  ttgaacaagg cttcatccct cccgttgcaa aggcagtctg aagattatag
   11251  attcgataat ggagaagttt tatccgttaa cgaactgaac tcgacacaac
   11301  ccggttcttg tgaaagggaa tttgtcattc ttctgactag cgaaattata
   11351  tacaaatggt gttctgtatg cggtctagac gtaaagatgg gtatgtcgac
   11401  tgttaacacc ggtagagatc tgaatttttc aaaagatcct ttcatatccg
   11451  tcgatgtgaa atcgactggt tgtaaattcc caatgaatga tataaagact
   11501  ttcctgggaa ccaaagggga tgatatcgaa ttggctgaac attgttggag
   11551  tttatccaac tcgtgcggtg aaatgattga tcctagtgat atttctcgat
   11601  ttaaagcgat cacgtttcgg agcgatagtg agtcgaaatc ggaagcagtc
   11651  acgagttccc gtgttatcga ttatttgtca cactgtttga gcatcgttga
   11701  catggtgtct ctacctagcc agaaagggga gaagcgtatg ttagacaaag
   11751  tcttcgagaa gtatttaact tacctcggtt catcgacatt agtaactaac
   11801  gggtgctgtg ataatcccct aatgaagggc gtagtgttcg atttcgtgcg
   11851  cgaaaatgca gcttacttgt caacttacgc taacaatatc aaaaactttt
   11901  cgatcttttc agctacgtat atgcctgtga tcgaagatac ctggcatttt
   11951  aaatggaatg agactccacc cgattttcgc ttactattcg actttacact
   12001  aactgatcta acggataagt cgttaccttt gctaaacgtg aacgatatgc
   12051  aagttgtctt gggttctcaa gtcaaatacg tcgagaatgt tttaatggac
   12101  gtcgatattt tatcaatgcg agattacata tacgctctga tgaaaaagag
   12151  caatagttgg gctgatgaga gcacgctgtg ggcggctttt cattgctatt
   12201  acggtacgta cagaacggct atctcaagag ttgtctcgag accattattg
   12251  tacgtccctc cgcctcagtt gacgactagg gtgattgact tctcaaccgt
   12301  cgaaaatcta ttcgatacac tgcagaagag gaaacccgat acgaatatca
   12351  gaaggcagtt ctgtggtaaa ctcggtgtag aagctatcgc gtgcttcaaa
   12401  gcgctgaaat tgtctttccc taagatatgt actcttaacg tcccgttaga
   12451  gtacggatac cttaatattg actactacaa gcatattccg ggaaggaatt
   12501  tatcggatga agagagactc attctatgca acataaaaga ttccgtgaac
   12551  gaaatgtgtc tcaacagagc tctaagcacg gagaaaagga acgctcagcg
   12601  tcatcctaaa ttattgccta acaaaaattc ttttcgtgac agagattcag
   12651  aacacaaacg aacgctttcg gtttctaaga atggccttga cgctctccga
   12701  cgccgattat attgctcaac cggcggcact gagagacgcc tctagcgaaa
   12751  tcgtagaaaa attttctgag ggtttggatg tgaactctat cacccactcc
   12801  accgattctg cgttttcaaa gaaagaggct gaagaagcta taccaggtgt
   12851  gttgtccagg ttaagggaat taacaaaagc ggacagcaaa caagatatag
   12901  ttcatttcat gatgcttatg tgtagagcac aaatcatctc gactagtatg
   12951  aaagttaagt atacaggatc ttactcttac acagtcggtg gtatgggttt
   13001  caccatcaag gatgcggata tttttccgca cataattcac atgctggcca
   13051  agtataagaa acctaacccg ttgagggcgt tattcacgac cttcgagact
   13101  ccgttcatcc atttcagtaa gatcagacca gacctcgcag aaactaggag
   13151  tgcctgcagg agaggaactc ccacaggata cggctacttg tcggccgact
   13201  ttctcactgg ctcgtcacca tctttaaatg atagagaaag agcgatcgtg
   13251  aacaggtcct ctgaacacgc gatcaataga gccaatctta ctggtgcttc
   13301  aaaagaatta gtgagtcttt acgatatagg agcatgaagt gacttactta
   13351  ctagtaaggg ttgtttgaga ctctgtccct caacggtcta cattcgaaac
   13401  tacttaaaga acgcatcgtt ccatttcact aattctgttt gaactcaagt
   13451  tttagccaca ctttaacatt tgtgtaatgg ttgacacggc cgggaaactc
   13501  gctgtcattg acgccttcaa cgttgaggac gaaaggatta tctcatctgt
   13551  ctcagacttg gctgaaatca ggcaaaaatt tgaaaaattt gtgactgaca
   13601  aacttcaggg agatctcaag gatctcgact tacacttggg tctcatacta
   13651  gtcgcatttg cgattaaaac tacctcaagg caggccgtaa aaggcgacgc
   13701  tgaattcgtt aactacactc tttcgggtca cgtttcgacg gcaactgaga
   13751  aagatataac cgaattcctc aattccctcc ctcaattgaa agataggaag
   13801  aataaggcta gagtgttttg ccgtagcttt gcgaaggaat acataaaaac
   13851  ttgcagatcc cacgctaatt ctctcccgaa gcaaacgcga gcgattaaac
   13901  tggggatacc tgacaggtac cactatttgc aagcggattt cgttacagat
   13951  tgctccgaac taaccgacga ggaacaagcc gtgttactgc acgggaggaa
   14001  ccacgcggtg gcgcctatta acagtgccgc cacgcctatt gtcactaacc
   14051  tgtacgagct cggaggtgga aaacgcaact gatgtcagaa gtctcgttct
   14101  cgataagacc tatagctgat ggtgacacta acactattgt catcataaga
   14151  gataaattcg gacatagcgt actgaatttc aaatcaccag ctggggatga
   14201  ttcgttagct ttggtcgagg aaagttgtat catttcgcgc tccgatttcg
   14251  aatcggtcgc gtcctgcgac gacagtttct tcttagctgg gttaaactct
   14301  ttagaagacg ctctcaacaa ctttgtttta cattcccctc gctcacttac
   14351  tgcgactagc gagagtctat cctcgttgga gtatattgac ttcgtgctag
   14401  acccgatcat gttgggtatc atctttcgat tcaacctaaa gagaagaata
   14451  aataatgata gcgtttcatt atttagggac agtctcataa gtttaaatgg
   14501  tgggtggtat aacggtactc tgtacgacga tatgtttcac tacctttcca
   14551  acttcttcaa acaaaagaaa ggttttacta ttcactcttt cgaactaatc
   14601  aaacagaatg aagttgtatt tccgagtcgc gtattacgag tctctggtga
   14651  ccgaggccac caacctattg actagggtac gtaaccgcga cgagaatcac
   14701  gatcgtgccg ctcttaacaa atggatcctc gatttcactg acttagcagc
   14751  gagggtccag tgcattaaaa gcgacgttaa tgacgctaaa cgcgaggaga
   14801  gtgcgcacga cattaatact aaagtggctc tactccaaac attcgagcag
   14851  cgcttagctg aagcgcgcga cgtgctccgt ctgatagtgg tgaaagatca
   14901  gttaaacctc gagagcaagg aactcctagc tttctttgtg aaatacttca
   14951  ccaacatcac accaacgtct ttcgatcacg ctatagagta tagcgtgcgg
   15001  caactggtga gcgccgtgtt actccatctt tccagcgaga gtggtctcga
   15051  catctccgct aacacgttca ggcagaacgt tttgttgaga tcgaacaata
   15101  aagttatcgt tgaatggaca cgacgtctgg gatacacaaa ggaacagcta
   15151  gctgacatgt gctcttaaag cacgaggtca gggttgatcc cactattaaa
   15201  ttaataaaat taaaataaaa acaaaaataa aaaatatata tcactcacaa
   15251  ccaaattgtg agtggccagt gcaaacccgt aggtattagc tttcccacgg
   15301  ccgacttaaa ccctcacaga gtgagagcgt gtaccagggt acatagcgtg
   15351  cgtgtaggtc ggtataatga ctgtactaga tgatcaaaag atcaccataa
   15401  cagtcttacc tgaatcaaag tcgcgattcg gggaaaccaa acaagcgccg