Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Kd major coat protein (CP25) gene, complete cds.

ACC No: AY803278

Dated: 2005-12-17 | Length: 672 | CRC: 195611067

                
ID   AY803278   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY803278;
XX
SV   AY803278.1
XX
DT   11-NOV-2004 (Rel. 81, Created)
DT   17-DEC-2005 (Rel. 86, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate Kd major coat protein (CP25) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barzegar A., Sohi H.H., Rahimian H.;
RT   "Comparative Sequence Analysis of Coat Protein Gene of Iranian Citrus
RT   tristeza virus Isolates";
RL   J. Phytopathol. 153(7-8):457-463(2005).
XX
RN   [2]
RP   1-672
RA   Barzegar A., Rahimian H., Hashemi Sohi H.;
RT   ;
RL   Submitted (13-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Plant Biotechnology, Nigeb, Tehran-Karaj Highway, Tehran 14155-6343, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="Iran:Fars Province, Khafr"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Kd"
FT                   /isolation_source="southern citrus groves"
FT   gene            1. .672
FT                   /gene="CP25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5U714"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U714"
FT                   /gene="CP25"
FT                   /product="major coat protein"
FT                   /protein_id="AAV51216.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAVSSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDTGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 126 C; 172 G; 179 T; 0 other;

ay803278 Length: 672  17-DEC-2005  Type: N  Check: 9997  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggtgtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa aggtatcggt aaccgcacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatacagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgc gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga