Sequence of DPV Grapevine Algerian latent virus

Grapevine Algerian latent virus strain nipplefruit 92K protein, 33K protein, 40k protein, 24k protein, and 19k protein genes, complete cds.

ACC No: AY830918

Dated: 2006-06-22 | Length: 4731 | CRC: 92224400

                
ID   AY830918; SV 1; linear; genomic RNA; STD; VRL; 4731 BP.
XX
AC   AY830918;
XX
DT   30-MAY-2005 (Rel. 84, Created)
DT   22-JUN-2006 (Rel. 88, Last updated, Version 3)
XX
DE   Grapevine Algerian latent virus strain nipplefruit 92K protein, 33K
DE   protein, 40k protein, 24k protein, and 19k protein genes, complete cds.
XX
KW   .
XX
OS   Grapevine Algerian latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4731
RA   Ohki T., Uematsu K., Nakayama Y., Lesemann D.-E., Honda Y., Tsuda S.,
RA   Fujisawa I.;
RT   "Characterization of Grapevine Algerian latent virus isolated from
RT   nipplefruit (Solanum mammosum) in Japan";
RL   J. Gen. Plant Pathol. 72(2):119-122(2006).
XX
RN   [2]
RP   1-4731
RA   Ohki T.;
RT   ;
RL   Submitted (18-NOV-2004) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, National Agricultural Research Center, 3-1-1
RL   Kna-nondai, Tukuba, Ibaraki 305-8666, Japan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4731
FT                   /organism="Grapevine Algerian latent virus"
FT                   /strain="nipplefruit"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /db_xref="taxon:208084"
FT   CDS             167. .2623
FT                   /codon_start=1
FT                   /transl_except=(pos:1055. .1057,aa:OTHER)
FT                   /product="92K protein"
FT                   /note="RNA-depentent RNA polymerase; readthrough stop
FT                   codon"
FT                   /db_xref="GOA:Q4VMI6"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VMI6"
FT                   /protein_id="AAX76898.1"
FT                   /translation="METIRRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFLVELLKTDCAAKWEWFMKRRQRGDYIVPLSIAALPVIPLLSYATKV
FT                   RAVSVKAFGNELSFNIRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRTGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARTPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYSGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTAK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQYEHSFYRAMYPGNKLLGKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLILER
FT                   RNLKQVQRTLPEYFLNLGFTMKVEAPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVETFYSRFKLYDTPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPESRASFWAAFGLTGDEQLALEDRLDRWDMDLFGEEGTDAHEPSI
FT                   LDSAVA"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /product="33K protein"
FT                   /note="putative RNA-dependent RNA-polymerase"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VMI5"
FT                   /protein_id="AAX76899.1"
FT                   /translation="METIRRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFLVELLKTDCAAKWEWFMKRRQRGDYIVPLSIAALPVIPLLSYATKV
FT                   RAVSVKAFGNELSFNIRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             2638. .3768
FT                   /codon_start=1
FT                   /product="40K protein"
FT                   /note="capsid protein"
FT                   /db_xref="GOA:Q4VMI4"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VMI4"
FT                   /protein_id="AAX76897.1"
FT                   /translation="MALALNTRRNNNGKVMEMLAYKAATAGAELALANVGGITRGVAQL
FT                   GKSMMGKKKRNKNVSQVGALGGAVVAPVAVTRQIRGSKPRFSGRGTGSITVTHREYLGQ
FT                   VVTTADLQVNGGITGNLLKVNPLNGILFSWLPTIAAGYDQYAFNRLSLQYVPLCATTAT
FT                   GRVAMYWDKDSTDLEPTDRVELANQAILKETSPWAEANLTIPTDRIKRFCDDSAVADRK
FT                   LVDLGQLGVATYGGTAVVAGDVFVSYTVTFYNPQPLATLMDTTRINASNTVITNVGPQY
FT                   SRIDVVSGNQWLITFRGVGKFVIFGSIRGTGAVVLALSGVIVNSSTTLTTPTGAMYVAN
FT                   VTVSSLPASLSYTMTTVTAGLHSAVRATRANDMGTP"
FT   CDS             3749. .4381
FT                   /codon_start=1
FT                   /product="24K protein"
FT                   /note="movement protein"
FT                   /db_xref="GOA:Q4VMI3"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VMI3"
FT                   /protein_id="AAX76896.1"
FT                   /translation="MIWAHLSACQARKGLLEQDQFMDTEYEQVNKPWNELYKEATLGNK
FT                   LTVNVGMEDAEVPLLPSNFLTKVRVSMSGGYITVRRVRIKIIPLVSRKAGVSGKLYLRD
FT                   ISDTTGRKLHCTELLDLGREVRLTMQHLDFLVSARSDVPIVFGFEDLVSPYLEGRELFS
FT                   VSLKWQFGLSAQCYSLPPAKWKVMYQEDALKALKPSKKKASKTDSSV"
FT   CDS             3844. .4362
FT                   /codon_start=1
FT                   /product="19K protein"
FT                   /db_xref="GOA:Q4VMI2"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VMI2"
FT                   /protein_id="AAX76895.1"
FT                   /translation="MERTIQGSDVREQANSERWDGGCGSTITPFKLPDESPSLYEWRLH
FT                   NSEESEDKDHPLGFKESWCFGKVVFKRYLRYDGTEASLHRALGSWERSSVNDAASRFLG
FT                   LGQIGCTYSIRFRGSCLTLSGGSRTLQRLIEMAIRTKCTMLQLAPCEVESDVSRRCPEG
FT                   TEAFEKESE"
XX
SQ   Sequence 4731 BP; 1243 A; 1002 C; 1319 G; 1167 T; 0 other;

ay830918 Length: 4731  22-JUN-2006  Type: N  Check: 7989  ..

       1  agaaattccc caggatttca cgacctagtt cgttgttatc tggtgacttg
      51  cgctaccgtt gctttgcgta gggaatttct ctccatagtt taactttgac
     101  tgtggggttt gaaggttggg tctacccttc ggggggataa attgtaactt
     151  ccaacaaaca agcgacatgg agaccatcag gagaatgatt tggcctaaga
     201  aagagatttt tgtgggtgat ttcgcgatcg gagttaatag gacggcaccg
     251  gtggacattt tccagttggt gtgccgtgta gtcctgagat acatgaggac
     301  agggaaaata gagtgtgatt ctgatagcat gacgaagttt ctagttgaac
     351  tacttaaaac tgattgtgct gccaaatggg agtggttcat gaagagacgg
     401  cagaggggtg attatattgt ccctctttct atagccgccc tcccggtcat
     451  accgctgttg agttatgcca cgaaggtacg tgcagtctca gtcaaagcgt
     501  tcggtaatga gctgtcgttc aatatccgag tgcctagacc atctgtgccc
     551  aagaaaggat tactcctcag actggcggca ggcttagcgc tcgcacctat
     601  atgcgcgcta gcagtgtacg ctacccttcc ccgggaaaaa ctgtcggtat
     651  tcaagcttag gactgaagca cgcgcacaca tggaggatga gagagaagcg
     701  acagattgtt tggtggttga gccggcacgg gagctcaagg gtaaggatgg
     751  tgaggatctc ctcactggta gtagaatgac taaggtaatc gcgtccacgg
     801  ggcgccctcg caggaggcct tacgcagcaa agattgcaca ggtcgcgaga
     851  gcaaaggtgg gttacctaaa gaatagtcct gaaaatagat tgatctacca
     901  gcgagtgatg attgagatca tggacaaaga ctgcgtcagg tatgttgaca
     951  gggatgtcat attgccattg gctattggat gctgttttgt ctatccggat
    1001  ggagtggagg agtcggcagc actatggggt tcgcaggaat cccttggtgt
    1051  caaataggga ggcctagtac gtctacctgg ggttgtgaca cagatcaatc
    1101  gagatatccc atctgatgtg ttgctccccc aggaggtgct agaggttcgt
    1151  acaggacctc ccaatgctaa ggaccgtaat atatttatgg ttgcaggttg
    1201  cccatcacag gcgcggttct tagtacacaa tcattgcctg aaaaacctca
    1251  aaaggggtct tgtggagaga gttttctgtg ttgagagaaa tggaaagctc
    1301  gctcgcactc cacaacctac caaaggagcc tttggacgtc tttccccgtt
    1351  caggaaagca gtttgtgaga aggttggagt agcccaccga cttgggtatg
    1401  atggatttct gtcgtactac agcggtgcga agctccgtac ttacacacga
    1451  gctgtggaga gtctgcatat cactcctgtc tcagagaggg atagtcatct
    1501  gactaccttc gtaaaggcag agaagatatc gacggctaaa ggtgacccag
    1551  cgcctagggt aattcagcct cgaaacccta ggtacaatgt ggaacttgga
    1601  agatatctgc ggcatatgga atccaagctg atgaaagctg tagatggcgt
    1651  gttcggagag acgacatgca tcaaaggata caccgctgat gaggtgggcg
    1701  ctattttcag agagaaatgg gacaggtttg ataagcctgt tgccataggt
    1751  cttgatgcgt ccaggtttga tcaacactgt tccgtggaag ctttgcaata
    1801  tgagcatagt ttctacaggg ccatgtaccc tggcaacaag ctcttgggca
    1851  agttgttgga gtggcagctc cataataaag ggaaggggta tgttcctgat
    1901  ggaactatca cctatcgtaa ggaaggctgt cgtatgagtg gggatataaa
    1951  cacctcgttg gggaattacc tattgatgtg tgcaatggta cacgggtaca
    2001  tgcgccattt ggggattaat gaatttagtc tggcgaactg tggggatgac
    2051  tgcgttctaa tcttggaacg tagaaatctc aaacaggtac agaggactct
    2101  acctgagtat ttcctaaacc tgggatttac catgaaggtg gaggcccctg
    2151  tatttcaatt ggaagaggtt gaattctgcc aggcacaccc tgtacagttt
    2201  caaggtggtt ggaagatggt ccggaacgtt cgcactgcca tgagcaaaga
    2251  cgtgcactgt gttaataata tacgcgatct tgcgacgagg agagcatgga
    2301  gtaatgccca gcatcatgga ggactggcgc ttagtgccgg tatacccgtg
    2351  gttgagacat tttactccag atttaagtta tatgacacac ctcgcaaaca
    2401  tcaacgtatt gacacggtca caaatgttca taaatggcgc ggatccggtg
    2451  ggagctatgt tgtgacccct gagtctaggg ctagcttttg ggcagccttt
    2501  ggtctcacgg gggatgagca actagctttg gaggaccgtc tggataggtg
    2551  ggatatggat ctgtttgggg aagagggtac tgatgcgcat gagcccagta
    2601  tccttgactc cgccgtagct tgaccaagta aacacaaatg gcattagcac
    2651  taaacacaag acggaacaac aacggtaagg tgatggaaat gttagcatat
    2701  aaagcggcca cggccggcgc tgagttggct ctcgccaatg tcggtggcat
    2751  aacccgtggt gtggcacaat tgggtaagag tatgatggga aagaaaaaga
    2801  ggaacaagaa cgtatcccaa gtgggtgcat taggtggggc agttgtagcc
    2851  cctgtggcgg ttaccagaca aatacgtggg tctaaaccca ggttttccgg
    2901  caggggaact ggtagcatta ctgttacgca tagagaatac ttgggccagg
    2951  tagtcacgac ggctgaccta caagtgaacg gaggcattac gggcaaccta
    3001  ctgaaggtaa atccattgaa tggaatactc ttctcttggt taccaactat
    3051  tgcagccggt tatgaccagt atgccttcaa taggctatca ttgcagtatg
    3101  tacctttgtg tgcaactaca gcgactggtc gtgtagcgat gtattgggat
    3151  aaggattcca cggatctgga acccactgat cgagtcgaac tggccaatca
    3201  agcaatcttg aaagagacgt cgccatgggc agaagcaaac ttaactatac
    3251  ccactgatcg catcaagaga ttctgcgatg atagtgcggt cgcagaccgc
    3301  aaacttgttg atctcggaca acttggagtg gctacatatg gggggacagc
    3351  ggtggttgcc ggggatgtgt ttgtcagtta cactgtcaca ttctataatc
    3401  cacagcctct ggccaccctc atggacacca cgcgtatcaa cgcctcaaac
    3451  accgtaatca ctaatgtggg gccacagtat tcacggatcg atgtagtgtc
    3501  aggcaatcaa tggctgataa cctttcgggg tgtcggcaag tttgtcatat
    3551  tcggtagcat acgtggcact ggggctgtcg ttttggccct aagtggagtt
    3601  attgtcaact cctccactac ccttaccaca cccacgggag caatgtatgt
    3651  ggctaacgtg accgtatcat cattaccggc aagcttatca tacaccatga
    3701  ccactgtaac agctggatta cattcggccg tccgtgcgac aagggcaaat
    3751  gatatgggca caccttagtg catgccaagc aagaaagggg cttcttgaac
    3801  aagaccagtt catggatact gaatacgaac aagtcaataa accatggaac
    3851  gaactataca aggaagcgac gttagggaac aagctaacag tgaacgttgg
    3901  gatggaggat gcggaagtac cattactccc ttcaaacttc ctgacgaaag
    3951  tccgagtctc tatgagtgga ggctacataa cagtgaggag agtgaggata
    4001  aagatcatcc ccttggtttc aaggaaagct ggtgtttcgg gaaagttgta
    4051  tttaagagat atctcagata cgacgggacg gaagcttcat tgcacagagc
    4101  tcttggatct tgggagagaa gttcggttaa cgatgcagca tctagatttc
    4151  ttggtctcgg ccagatcgga tgtacctata gtattcggtt tcgaggatct
    4201  tgtctcacct tatctggagg gtcgcgaact cttcagcgtc tcattgaaat
    4251  ggcaattcgg actaagtgca caatgttaca gcttgccccc tgcgaagtgg
    4301  aaagtgatgt atcaagaaga tgccctgaag gcactgaagc cttcgaaaaa
    4351  gaaagcgagt aagacagact cttcagtctg agttggtgga tgtgagtgta
    4401  ctttgtttga gcatacaggt tactcttagt atgattaggt ctacgtgatg
    4451  acgagtcagg tcaggctccg cactgggttt ggtcgcccag gggatggaga
    4501  cacggaaagg acatcgtgtg ctataagtct gacgtaagtc gagcttgcaa
    4551  catgggtcta tgcctggata agtcacgtgg ttgcccctac tatgaattgg
    4601  atgcctgttt acgactagca aacgacactc gtggaaacta atttggacac
    4651  ggttgatctc acccttcggg ggggctatag agatcgctgg aagcactacc
    4701  ggacaaccgg aacattgcag aaatgcagcc c