Sequence of DPV Reticuloendotheliosis virus

Reticuloendotheliosis virus strain HA9901 from China, complete genome.

ACC No: AY842951

Dated: 2005-04-17 | Length: 8295 | CRC: 1132727652

                !!NA_SEQUENCE 1.0
ID   AY842951   standard; genomic DNA; VRL; 8295 BP.
XX
AC   AY842951;
XX
SV   AY842951.1
XX
DT   23-JAN-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Reticuloendotheliosis virus strain HA9901 from China, complete genome.
XX
KW   .
XX
OS   Reticuloendotheliosis virus
OC   Viruses; Retroid viruses; Retroviridae; Gammaretrovirus.
XX
RN   [1]
RP   1-8295
RA   Wang Y., Cui Z.;
RT   "Sequence analysis of the complete proviral genome of reticuloendotheliosis
RT   virus chinese strain HA9901";
RL   Unpublished.
XX
RN   [2]
RP   1-8295
RA   Wang Y., Cui Z.;
RT   ;
RL   Submitted (01-DEC-2004) to the EMBL/GenBank/DDBJ databases.
RL   Preventive Veterinary Medicine, Shandong Agricultural University, 61
RL   Daizong Street, Taian, Shandong 271018, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8295
FT                   /country="China"
FT                   /db_xref="taxon:11636"
FT                   /mol_type="genomic DNA"
FT                   /note="from meat-type fowl flock"
FT                   /proviral
FT                   /organism="Reticuloendotheliosis virus"
FT                   /strain="HA9901"
FT                   /specific_host="Gallus gallus"
FT   LTR             1. .550
FT   primer_bind     551. .940
FT   CDS             941. .2443
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G5J9"
FT                   /db_xref="UniProt/TrEMBL:Q5G5J9"
FT                   /product="gag protein"
FT                   /protein_id="AAW57299.1"
FT                   /translation="MGQAGSKGLLTPLECILKNFSDFKKRAGDYGGDVDSFTLRKLCES
FT                   EWPTLGVGWPKEGTLDFGVVVAVRNIVFGKHEGHPDQVIYITVWTDITIERPKYLKDCG
FT                   CKPTGPSKVLLASQKVNPRRPVLPSAPESPPRTRRAQFLDERPLSPAPAPPPPYPEVPA
FT                   IAEEGEEGQQPDSTVMASPPHTRSGLEFGAQGPSGMYPLRETGERDMGGRPMRTYVPFT
FT                   TSDLYNWKNQNPSFSQAPDEVISLLESVFYTHQPTWDDCQQLLRTLFTTEERERVRTES
FT                   RREVRNDQGVQVTDEREIEAQFPATRPDWDPNTGRGNDNLERYRQILLRGLRAAARKPT
FT                   NLSKITEVRQGADESPTAYLERLYQAYRTWSPIDPRAPENQAAIVIQFVSQSAPDIRKK
FT                   IQKIDGFQGKSLSELVAIAQKVFDQREDPAKATHELTRKMAKVLLAQESRAERGSKKTP
FT                   PGKGRPPLGKNQCAYCKEEGHWKKNCPKLVSGATPVLVEELQ"
FT   CDS             <2444. .6025
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G5J8"
FT                   /db_xref="UniProt/TrEMBL:Q5G5J8"
FT                   /product="protease/polymerase"
FT                   /protein_id="AAW57300.1"
FT                   /translation="GRQGSSALREPRLKVKVGGQIIDFLVDTGATHSVVQKPVGPMSKE
FT                   SVAIIGATGNIRNYPKSEGRLVDLGRGLVTHSFLVIPECPDPLLGRDLLQKLRATISFT
FT                   GGGPPEIRTEGKLLVTAPLEEEYRLFLEAPIQNVTLLEQWKRGIPKVWAEINPPGLAST
FT                   QAPIHVQLLSTALPVRVRQYPITLEAKRSLRETIHKFRAAGILRPVHSPWNTPLLPVRK
FT                   SGTSEYRMVQDLREVNKRVETIHPTVPNPYTLLSLLPPDRIWYSVLDLKDAFFCIPLAP
FT                   ESQLIFAFEWADAEEGESGQLTWTRLPQGFKNSPTLFDVALNRDLQGFRLDHPSVSLLQ
FT                   YVDDLLIAADTQAACLSATRDLLMTLAELGYRVSGKKAQLCQEEVTYLGFKIHKGSRSL
FT                   SNSRTQAILQIPVPKTKRQVREFLGTIGYCRLWIPGFAELAQPLYAATRGGNDPLVWGE
FT                   KEEEAFQSLKLALTQPPALALPSLDKPFQLFVEETSGAAKGVLTQALGPWKRPVAYLSK
FT                   RLDPVAAGWPRCLRAIAAAALLTREASKLTFGQDIEITSSHNLESLLRSPPDKWLTNAR
FT                   ITQYQVLLLDPPRVRFKQTAALNPATLLPETDDTLPIHHCLDTLDSLTSTRPDLTDQPL
FT                   AQAEATLFTDGSSYVRDGKRYAGAAVVTLDSVIWAEPLPIGTSAQKAELIALTKALEWS
FT                   KDKSVNIYTDSRYAFATLHVHGMIYRERGLLTAGGKAIKNAPEILALLTAVWLPKRVAV
FT                   MHCKGHQKDDAPTSTGNRRADEVAREVAIRPLSTQATISDAPDMPDTETPQYSNVEEAL
FT                   GHRLRGTKDPAGWWHLPDGRLLLPRAVGRKVLEQTHRATHLGESKLTELVRKHYLICGI
FT                   YRAARDITTRCVACAQVNPGAAPVEKGLNSRIRGAAPGEHWEADFTEMITAKGGYKYLL
FT                   VLVDTFSGWVEAYPAKRETSQVVIKHLIHDIIPRFGLPVQIGSDNGPAFVAKVTQQLCE
FT                   ALNVSWKLHCAYRPQSSGQVERMNRTLKETIAKLRKETGGDWVSLLPQALLRARCTPGR
FT                   EGLSPFEILYGLKPPVVPRVGCDKLASITNQTLLKSLQALQATRSLARATLRDQLPQKE
FT                   AQQDRTPLFQPGDLVFVKKHDFQQLGPRWDGPYTVVLSTPTAVKVAGKTPWIHYSRLKK
FT                   APDNQEEWTVSPTSDPLRVKLTRRAKP"
FT   CDS             5962. .7716
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5G5J7"
FT                   /db_xref="UniProt/TrEMBL:Q5G5J7"
FT                   /product="envelope glycoprotein"
FT                   /protein_id="AAW57301.1"
FT                   /translation="MDCLTNLRSTEGKVDQAGKTLILLVVWWGFGTTAESHPSQQLWGL
FT                   PCDCSGGYVSPTPTHYTNSLDCGSFTAYLTYGSGAGSWGWGGGFRQQWECVFKPKIIPS
FT                   VQEQPRPCECLTIATQMHSTCYEKAQECTLMGKTYFTAILQKTKLGSYEDGPNKLLQAS
FT                   CTGIIGKPVCWDPAAPVYVSDGGGPTDMIREESVRERLEEIIRHSYPSVQYHPLALPRP
FT                   RGVDLDPQTSDILEATHQVLNATNPRLAENCWLCMTLGTPIPAAIPANGEVTLDGNCSL
FT                   SLPFRVQPTGSVDVNCYAGEADNRTGIPVGYVHFTNCTSIQEVSNETSHIRNLTRLCPP
FT                   PGHVFVCGNNMAYTALPNKWIGLCILASIVPDMSIISGEEPIPLPSIEYTAGRHKRAVQ
FT                   FIPLPVGLGITGATLTGGTGLGVSVHTYHKLSNQLIEDVQALSGTINDLQDQIDSLAEV
FT                   VLQNRRGLDLLTAEQGGICLALQEKCCFYANKSGIVRDKIRKLQEDLLARKRALYDNPL
FT                   WNGLNGFLPYLLPLLGPLFGLILFLTLGPCIMKTLTRIIHDKIQAVKILALVPQYKPLP
FT                   TEMDTLGQ"
FT   misc_feature    7717. .7745
FT                   /note="ppt; polypurine tract"
FT   LTR             7746. .8295
XX
SQ   Sequence 8295 BP; 2084 A; 2172 C; 2200 G; 1839 T; 0 other;

 AY842951  Length: 8295  June 13, 2005 09:39  Type: N  Check: 7571  ..

       1  aatgtgggag ggagctccgg gggggggaat agcgctggct cgctaactgc
      51  cgtattagct tctgtaatca tgcttgcttg ccttagccgc cattgtactt
     101  gatatatttc gctgatatca tttctcggaa tcagcatcat ttctcggaat
     151  cggcatcaag agcaggctca tagaccataa aaggaaatgt ttgttgaagg
     201  caagcatcag gccacttgcg ccatccaatc acgagcaaac acgagatcga
     251  actatcatac tgagccaatg gttgtaaagg gcagatgcta tcctccaatg
     301  agggaaaatg tcatgcaaca tcctgtcctg taagcggcta tataagccag
     351  gtgcacctct tgctcggggt cgccgtccta cacattgttg tgacgtgcgg
     401  cccagattcg aatctgtaat aaaagttttc ttttcttcta tatcctcaga
     451  ttggcagtga gaggagattt tgttcgtggt gtaggctggc ctactgggtg
     501  gggttgggat ccggactgaa tccgtagaat ttctgtacaa catttggggg
     551  ctcgtccggg attcctcccc atcggcagag gtgcctactg tttcttcgaa
     601  ctccggcgcc ggtaagtaag tacttgattt tggtacctcg cgaggatttg
     651  ggaggatcgg agtggcggga cgctgccggg aagctccacc tccgctcagc
     701  aggggacgcc ctgatctggg ttctgtggta tctgattgtt gttgaaccgt
     751  ctccaagacg gtggtaatat aagtcgtggt ttgtgtgttt gtttgttacc
     801  ttgtgtttgt tcgtcacttg tcgacagcgc cctgcgaatt ggtgtgccca
     851  caccgcgcgg cttgcgaata atactttgga gagtcttttg cctccagtgt
     901  cttccgtttg tactcgtcct cctctccctc tccggccggg atgggacagg
     951  caggatcgaa ggggctttta acccctctag agtgcattct gaagaacttc
    1001  tctgacttta agaagagggc gggagactat gggggggatg tggattcgtt
    1051  taccctgcgc aagttatgtg agtcggaatg gcccacgttg ggcgtggggt
    1101  ggccaaagga agggactcta gactttgggg tggtagtcgc ggtcaggaat
    1151  atagtttttg ggaaacatga agggcatcca gaccaggtaa tatatataac
    1201  cgtctggaca gatataacca tagaaaggcc taaatacttg aaagattgtg
    1251  ggtgtaaacc cacaggaccc tctaaagttc tgttagctag ccaaaaagtt
    1301  aatcccaggc ggcccgtgct cccctcagcc cccgaaagcc cccctcggac
    1351  aaggagggct caattcctgg atgagagacc tctctctccg gccccagccc
    1401  ctccacctcc atatcctgag gtacctgcca ttgcagagga aggtgaggag
    1451  gggcaacaac cagactctac tgtaatggcg agccctcccc acacccgaag
    1501  tggattagag ttcggagcac aagggccgtc agggatgtac ccccttaggg
    1551  aaactgggga acgggatatg ggtggtcgcc ccatgagaac atatgtccca
    1601  ttcaccacct cggatctgta taattggaaa aaccaaaacc catcattctc
    1651  ccaggctcca gatgaagtaa ttagcctact agaatctgtt ttctatacgc
    1701  accagcccac ctgggatgat tgccagcaac tcctccgtac cctgtttacg
    1751  acggaggaga gggagagggt gaggacagaa agtaggcggg aggtcaggaa
    1801  tgatcaagga gtacaggtca ctgacgagcg cgaaatagaa gcccagttcc
    1851  cagctactcg gcccgactgg gatcctaaca cagggagagg aaacgacaat
    1901  ctagaacgat atcgccagat cttgctgagg gggctccggg cagcggcacg
    1951  gaaacccacc aatctttcta aaataactga ggttcggcag ggggcggacg
    2001  aaagccctac agcttacctg gagagactct atcaggctta tcggacctgg
    2051  tcccccatag atccaagggc acccgagaat caggctgcca tagtcattca
    2101  atttgtatct caatccgcgc ccgatattag gaagaaaatc caaaagatag
    2151  atgggttcca gggaaaatct ctctccgagt tagtagctat tgcccagaag
    2201  gttttcgacc aacgggagga cccagccaag gcaactcacg agctcacccg
    2251  gaagatggcc aaggtactac tcgcccagga gagtagagcg gagagaggaa
    2301  gtaagaagac gcctccgggt aagggacgcc cgcccttggg gaaaaaccaa
    2351  tgcgcgtact gtaaggagga gggacattgg aagaagaact gtccaaaact
    2401  cgtaagcggg gcaaccccag tgttggtaga agaattacag tagggccgtc
    2451  agggttcttc cgccctccgt gaacccaggc taaaggttaa agtagggggg
    2501  caaataatag attttctagt agatacggga gcgacccatt ctgtagtgca
    2551  gaaacctgtg gggcctatgt ctaaggaatc tgtagcaatt atcggggcta
    2601  ctgggaatat acggaattac cctaagtctg aagggcgtct tgtggaccta
    2651  gggaggggac tagtgactca ttcatttcta gtgattcctg agtgcccaga
    2701  cccactattg gggagggatc tattacagaa gctaagggct accatctcgt
    2751  tcaccggggg agggcccccc gaaatacgga cagaagggaa actattggta
    2801  acggctcccc tggaagagga ataccgtttg tttttagagg cgccgataca
    2851  aaatgttacg ctgctagagc agtggaaacg gggaatcccg aaagtctggg
    2901  ccgagataaa tcccccgggg ttggcatcca cacaagcccc cattcatgtc
    2951  cagctactaa gtaccgccct acctgtgagg gtaagacagt atcctattac
    3001  cctggaggca aaacgaagcc tgcgcgaaac tattcacaaa ttcagagcag
    3051  cgggcatcct gagacccgtc cactccccct ggaacactcc cctcctccct
    3101  gtgcgaaagt ccggcacgtc cgagtatcgg atggttcaag atttaaggga
    3151  agtaaacaag agggtagaga ctattcaccc aactgtccct aacccataca
    3201  ccctcctcag cctattgccc cctgaccgaa tatggtattc tgttttggac
    3251  ctgaaagacg cttttttctg catccctctg gcccccgagt cgcaattgat
    3301  cttcgcattc gagtgggcag atgcggagga aggagaatca gggcaactaa
    3351  cctggactag gctacctcag ggttttaaga actcacccac cctttttgat
    3401  gtagccctta acagggatct gcagggattt cgacttgatc acccttccgt
    3451  ttccctcctt cagtatgtag acgacttact tattgcggct gatacacaag
    3501  ccgcgtgcct gagcgccacc cgagacttac tcatgacttt ggcggagctg
    3551  gggtaccggg tttcagggaa gaaggcccag ctctgtcaag aggaagtcac
    3601  atacttgggg ttcaagatcc ataagggatc acggtcccta tcgaatagcc
    3651  gaactcaggc tattcttcag ataccagtac cgaaaaccaa aaggcaggtg
    3701  cgcgaatttt taggcacaat tgggtactgc aggctttgga tcccggggtt
    3751  tgccgaactt gcccagcccc tatatgcggc aacgcggggg ggaaacgatc
    3801  ctttagtgtg gggcgaaaaa gaggaagaag cgttccagag cttgaaacta
    3851  gccctcaccc agccaccagc tttggctctg ccctccctag ataagccctt
    3901  ccagctcttc gtagaagaaa caagcggggc ggccaaggga gtgctcacac
    3951  aggccctcgg tccatggaaa agacccgtag cctacttatc caaaaggctg
    4001  gaccctgtgg cggctggctg gccccggtgc ctccgagcca ttgcggcagc
    4051  cgctcttctc acaagagaag cctctaaact taccttcggg caggacatag
    4101  agatcacttc gtcccataac ttggagagtt tgctgcgatc ccctcctgac
    4151  aagtggttga ccaatgctcg catcacgcag taccaggtac tgctcctgga
    4201  ccctccccga gtgcgcttta agcagactgc ggccctcaat ccggctaccc
    4251  tgttacccga gacagacgat acactgccaa tacaccattg cctggacact
    4301  ttagattctc tgacctccac ccgccccgac ctgacggatc agcccctggc
    4351  acaagcggaa gccactctgt tcactgacgg cagcagctac gtacgagacg
    4401  gaaaacgata cgccggtgca gcagtggtaa ctctggattc tgttatttgg
    4451  gcagaacccc tcccaattgg aacatcagcc cagaaagcag aattgatcgc
    4501  actaacaaag gccctggaat ggagcaagga caagagcgtc aacatctaca
    4551  cggatagccg ttatgcattc gccactctac acgtccatgg gatgatctac
    4601  agagaaaggg gactgttgac agcaggggga aaggctatca aaaacgcccc
    4651  cgaaattcta gccttgctga ccgcggtctg gctacctaaa cgggtggctg
    4701  tgatgcattg caagggacac cagaaagacg atgcacccac gtcaactggt
    4751  aaccgacggg cagatgaggt ggctcgagaa gtagctatac gtcctttgag
    4801  cacccaggcc accatctccg atgcaccgga tatgccagat accgaaaccc
    4851  ctcagtattc gaatgtagag gaggctctag gacatcggct gagggggacc
    4901  aaagaccctg ctgggtggtg gcaccttcct gacgggcgcc tcttgcttcc
    4951  cagagcagtg gggagaaagg tcctagagca aactcacaga gccacacatt
    5001  tgggtgaatc aaaattgact gagttagtta gaaaacacta tcttatctgt
    5051  gggatttatc gagcagctag agatatcacc acccgctgtg tggcatgtgc
    5101  ccaggtaaac cctggagcag ctcccgtgga gaaaggactc aattcccgta
    5151  tcagaggtgc ggcgccaggg gaacactggg aggcggattt cacagaaatg
    5201  ataacagcca aaggggggta taaatacctg cttgtactgg tagacacatt
    5251  ctcgggctgg gtagaggcat atccagcaaa gagagaaacc tcccaggtgg
    5301  taattaagca tctaattcat gatattatcc ccaggtttgg gttaccggtc
    5351  cagatcgggt ccgacaatgg gccggccttt gtggcaaaag tgacacagca
    5401  gttgtgtgag gccctaaatg tctcttggaa gctccattgt gcataccgac
    5451  ctcaaagctc gggacaggta gaaaggatga accgaaccct gaaggagacc
    5501  atcgctaaat tgaggaaaga gacaggaggg gactgggtct ccctcctccc
    5551  tcaggctttg ctccgggcac gatgtacccc cgggagggag ggattgtcac
    5601  ccttcgagat attatatggt ctcaagcctc ctgtagttcc ccgtgtagga
    5651  tgtgacaagc ttgccagcat aaccaaccaa accctgctta agtccctaca
    5701  ggccctccaa gctactaggt ctctggctcg ggcaacgctg cgcgaccaac
    5751  tgccccagaa agaagctcag caagaccgta ccccactgtt ccaacctggt
    5801  gacctcgtct tcgttaagaa gcacgacttc cagcagttgg ggccacggtg
    5851  ggacggaccc tacactgtag tcctcagtac ccccaccgcg gtaaaggtcg
    5901  ctgggaagac cccgtggatc cactactctc gactcaagaa agctcctgac
    5951  aaccaagaag aatggactgt ctcaccaacc tccgatccac tgagggtaaa
    6001  gttgaccagg cgggcaaaac cctaattctt cttgtggttt ggtgggggtt
    6051  tgggaccact gccgagagtc acccctcgca gcaactttgg ggactgcctt
    6101  gtgactgctc cgggggatat gtctccccca cacctaccca ttacaccaac
    6151  tccctcgatt gcggtagctt caccgcctac ctgacttacg ggtctggggc
    6201  agggagttgg ggctggggag ggggatttag acaacagtgg gagtgtgtgt
    6251  ttaaacccaa gatcataccc tctgtgcagg agcagccaag gccctgcgaa
    6301  tgcctcacga tagccaccca aatgcattcc acctgttatg aaaaggctca
    6351  ggaatgcacc ctcatgggaa aaacttattt tactgccatc ctacagaaaa
    6401  caaagctagg ttcgtatgaa gacgggccta ataaactgct tcaagcctct
    6451  tgcacgggaa tcatagggaa accagtatgt tgggaccccg cagcccctgt
    6501  gtatgtctct gatgggggcg gtcccactga catgattcgg gaagaatctg
    6551  tgcgtgaaag actagaggaa atcatcaggc acagctaccc ctccgtacag
    6601  tatcaccctt tagccctgcc ccgaccaaga ggagtagacc tggatcccca
    6651  gacgtctgac atactggaag ctactcacca ggtccttaac gccactaatc
    6701  cccggctagc agagaactgc tggctttgca tgactcttgg aactccaatc
    6751  cccgcagcca tcccggcgaa tggcgaagtc accctcgatg gaaattgcag
    6801  tcttagcctc ccctttcggg tgcaacccac cgggtcagta gatgtcaact
    6851  gctatgcagg ggaagcagac aataggactg gtatacccgt agggtatgtt
    6901  catttcacca actgcaccag catccaggag gtctctaacg agacaagtca
    6951  cataagaaat cttacgaggc tatgtcctcc accgggtcat gtatttgtgt
    7001  gtgggaacaa catggcctac acggcgctcc ctaataaatg gatagggttg
    7051  tgcatactgg catcaatcgt acccgacatg agcataatat ccggggaaga
    7101  gcctatccca ctcccatcca tcgagtacac cgccgggcgt cataagagag
    7151  cagtccagtt tatccccctg cctgtaggtc tagggattac aggggctaca
    7201  cttactggtg gaactgggct tggggtttcc gttcacactt atcacaagct
    7251  ttctaatcaa ttgattgaag atgtccaggc tctttcaggg accatcaatg
    7301  acctacagga ccagattgac tccctggctg aggttgtctt acaaaataga
    7351  agggggttag acctattgac tgccgaacaa ggagggatat gtctcgcact
    7401  ccaggagaag tgctgttttt acgccaacaa gtcgggtatc gtacgtgaca
    7451  agatccggaa actccaagag gaccttctcg cgaggaaacg tgcactgtac
    7501  gacaaccccc tgtggaacgg cttgaacggc ttccttccat atttgctacc
    7551  cttgttgggc cccctgtttg ggctcatatt gttcctgacc ctcggcccgt
    7601  gcatcatgaa gaccctgact cgcattatcc atgataaaat tcaggcagta
    7651  aaaatcctcg cattagtccc gcagtacaag ccactcccaa cagagatgga
    7701  taccctaggt caatgatttg accagaatat gcaagagcag tggggaatgt
    7751  gggagggagc tccggggggg ggaatagcgc tggctcgcta actgccgtat
    7801  tagcttctgt aatcatgctt gcttgcctta gccgccattg tacttgatat
    7851  atttcgctga tatcatttct cggaatcagc atcatttctc ggaatcggca
    7901  tcaagagcag gctcatagac cataaaagga aatgtttgtt gaaggcaagc
    7951  atcaggccac ttgcgccatc caatcacgag caaacacgag atcgaactat
    8001  catactgagc caatggttgt aaagggcaga tgctatcctc caatgaggga
    8051  aaatgtcatg caacatcctg tcctgtaagc ggctatataa gccaggtgca
    8101  cctcttgctc ggggtcgccg tcctacacat tgttgtgacg tgcggcccag
    8151  attcgaatct gtaataaaag ttttcttttc ttctatatcc tcagattggc
    8201  agtgagagga gattttgttc gtggtgtagg ctggcctact gggtggggtt
    8251  gggatccgga ctgaatccgt agaatttctg tacaacattt ggggg