Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate 93/955, complete genome.

ACC No: AY881628

Dated: 2005-08-01 | Length: 16494 | CRC: -1162829929

                !!NA_SEQUENCE 1.0
ID   AY881628   standard; genomic RNA; VRL; 16494 BP.
XX
AC   AY881628;
XX
SV   AY881628.1
XX
DT   01-AUG-2005 (Rel. 84, Created)
DT   01-AUG-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate 93/955, complete genome.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-16494
RA   Meng B., Li C., Goszczynski D., Gonsalves D.;
RT   "Genome sequences and structures of two biologically distinct strains of
RT   Grapevine leafroll-associated virus 2 and sequence analysis";
RL   Virus Genes 0:0-0(2005).
XX
RN   [2]
RP   1-16494
RA   Meng B., Li C., Goszczynski D., Gonsalves D.;
RT   ;
RL   Submitted (07-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Department of Molecular and Cellular Biology, University of Guelph, 50
RL   Stone Road East, Guelph, Ontario N1G 2W1, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .16494
FT                   /country="South Africa"
FT                   /db_xref="taxon:64003"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /isolate="93/955"
FT   gene            106. .8916
FT                   /gene="ORF1a"
FT   CDS             106. .8916
FT                   /codon_start=1
FT                   /note="encodes papain-like protease, methyltransferase and
FT                   helicase"
FT                   /gene="ORF1a"
FT                   /product="polyprotein"
FT                   /protein_id="AAX31603.1"
FT                   /translation="MSSLAISTLPCSVAQLSFGQPVAAVAKSFLMTSLPSLQTYPSLSE
FT                   LTSFSFCFGVFQNLKMFMSFLRSVHVFASFSELSTFGSCYEFIRLGGGAHPLFFCSFQC
FT                   GPLSVSLGLVNGVFAVLNLSFPFLSNASLLMDVGKDVVQVKRKISKLEKKQKKRVFSMA
FT                   RAAARYVPSPRNPKEKRAVHVQPLPSGSFRFSQDKNKTELIILSKEAGLVARVKCSACV
FT                   VRRRGYGGAVKSVALIALSPFGVKFRCFAPSCSTSACLKLRIVRRVAVGDCRGEKVIAA
FT                   RRAELQKQNFNSRTPKKVRENPAGALEANSEASATSRVIFFGSFTQPFALYPHQESAKA
FT                   NMQHPPVSVVTVERAVAKVAPERSVVDKVPTSVGVSPQRGVFSPPTVVRNCGDIVVTGV
FT                   VHEALKKIKDGLLRFRIGGDMRFSRFFSSNYGCRFVANVRTNTTVWLNCTKASGEKFSL
FT                   AVACSVDYVAMLRYVCGGKFPLVLMSRINYQDGHCYLAHMRYLCAFYCRPFRESDYALG
FT                   SWPTVARLKACVEKNFGVEACGIALRGYYTSRNVYHCDYDSSYMRGFRNLSGRVGGGSF
FT                   DPSSLTSVITVKTSGLPDSRPKSIVFGAFRCDIRYIEPADSGGVQSSAKMKREEVRRVV
FT                   KKCAAGEAAAQSRRKKIEEKYRDGIPDGGFPHLLAGNLNEVRRKVAAGVLRFRVGGDMD
FT                   FHRSFTTHSGYHLLVWRRSSRSVCIELYSPSKAFLRYDFLPCSVDYAAMFSFAAGGRFP
FT                   LVLMTRIKYLNGFCYLAHCRYACAFLLKGFDPKRFDIGAFPTAADLRRRMVSVLGDRSL
FT                   GLNLYGAYTSRGVFHCDYDAKYIKDLRRMSAVIAGKDGVEEVVPSDITPAMKQKTIEAV
FT                   YDRLYGGTDSLLKLSIEKDLIDFKNDVQSLKKDRPIVKVPFYMSEATQNSLTRFYPQFE
FT                   LKFSHSSHSDHPAAAASRLLENETLVRLCGNSVSDIGGCPLFHLNSKTQRRVHVCRPVL
FT                   DGKDAQRRVVRDLQYSNVRSGDDDKILEGPRNVDVCHYPLGACDRESSAMMMVQVYDAS
FT                   LYEICGAMIKKKSHITYLTMVTPGEFLDGRECVYMESLDCEIEVDVHADVVMYKFGSSC
FT                   YSHKLSVIKDIMTTPYLMLGGFLFSVEMYEVRMGVNYFKITKSEVSPSVSCTKLLRYRR
FT                   ANSDVVKVKLPRFDKKRRMCLPGYDTIYLDSKFVSRVFDYVVCNCSAVNSKTFEWVWSF
FT                   IKSSKSRVIISGKIIHKDVNLDLKYVESFAAVMLASGVRSRLASEYLAKNLSHFSGDCS
FT                   FIEATSFVLREKIRNMTLNFNERLLQLVKRVAFATLDVSFLDLDSTLESITDFAECKVA
FT                   VELDELGCLRAEAENEKIRNLAGDSIAAKLASEIVVDIDSKPPLRQMSNSSSENVDKRE
FT                   IQRPGLRGGSRIGVVGEFLHFVVSSALRIFKYATDQQRIKSYVRFLDSAVSFLDYNYEN
FT                   LSFIMQVLSKGYSCMFTFFANRGDVSSRIRSAVCAVKEVAASCASASVSKAKVMITFAA
FT                   AVCAMMFNSCGFSGDGREYKSYVHRYTQVLFDTIFFEDSSYLPIEVLSSAICGAIVTLF
FT                   SSGASVSLNAFLLQITKGFSLEVVVRNVVRVTHGLSTTATDGVIRGVFSQIMSHLLVGS
FT                   TGNVAYQLAFIAGVVPLLVKKCVSLIFIMREDTYSGFIKHGISEFSFLSSVLTFLKGKL
FT                   VDELKSVIQGVFESNKHVFKEATQEAIRTTVMQVPVAVVDALKCAAGRVYNSFASRRTF
FT                   GKDNGSSSEDACEEYFSCDEGDGPGLKGGSSYGFSVLAFFSRIIWGARRFIAKMKHECF
FT                   GKLFDFLSLRLHEFRTRVFGKNRADVGVYDFLPTDIVETLSSIEECDQIEELLGDDLNG
FT                   VKDDSLTDMSYFEFSEDFLASVEEPPFAGLRGGSKNVTILAILEYVYNLFRIVANKCSK
FT                   GPLLVAFAELSSALIERFKGKFSRKNKIFTIVREYALSSLRCRMRALGLNNDFVVNSFA
FT                   DLLPMLVKRKVSNSFLSSVYRPIKSFSYMCASAERREKFLALVCLVGLSLPFFVRIVGA
FT                   KACEELVSSARRFCERVKVFLKQKCVSLLSFLSCLFFSDAGDSSASAGLRGGASRVTLF
FT                   HLFVRLASALLSLGWEGLKLLLSHHNLLFLCFAMVDDVNVFVKALGGLSFFVQPVSSVF
FT                   AAVLLQPDRFAGYSEKLVTAFEFILKCSPRAPALLKTFFEGVANSTVSKTVRKLLRFLV
FT                   RKFKLRKRGGLRADGKGFHRQKAVPVIPSNRITTDGVERLSVKMQGVEALRTELRVLED
FT                   LDSAVIEKLNRRRNRDTSDDEFTRPAYEQIQEVTTFCSKANSAGLALERAVLVEDAVKS
FT                   EKLSKTIDEMARKGATTSDEVAVALSDDEAVEEISVAEERDDSPKTVRMSEYLNRLNSS
FT                   FEFPKPIIVDDNKDTGGLTNAVREFYYMQELALFEIHSKLCTYYDQLRIVNFDRSVAPC
FT                   SEDAQLYVRKSGSTIVQGKEARLHIKDFHDHDFLFDGRISINKRRRGGNVLYHDNLAFL
FT                   ASNLFLAGYPFSRSFVFTNSSVDILLYEAPPGGGKTTTLIDSFLKVFKKGEVSTMILTA
FT                   NKSSQVEILKKVEKEVSNIECQKRKDKRSPKKSIYTIDAYLMHHRGCDADVLFIDECFM
FT                   VHAGSVLACIEFTRCHKVMIFGDSRQIHYIERNDLDKCLYGDLDRFVDLQCRVYGNVSY
FT                   RCPWDVCAWLSTVYGNLIATVKGESEGKSSMRINEINSVDDLVPDMGSTYLCMLQSEKL
FT                   EISKHFIRKGLTKLNVLTVHEAQGETYARVNLVRLKFQEDEPFKSIRHITVALSRHTDS
FT                   LTYSVLAARRGDATCDAIQKAAELVNKFRVFPTSFGGSVINLNVKKDVEDNSRCKASSA
FT                   PLSVINDFLNEVNPGTAVIDFGDLSADFSTGPFECGASGIVVRDNISSSSITDHDKQRV
FT                   "
FT   gene            <8915. .10294
FT                   /gene="ORF1b"
FT   CDS             <8915. .10294
FT                   /codon_start=1
FT                   /note="RdRP; putatively translated through a +1 frameshift
FT                   mechanism"
FT                   /gene="ORF1b"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAX31604.1"
FT                   /translation="SVVRSQAIPRRRPSLQENLYSFEARNYNFSTCDRYTSASMFGEAM
FT                   AMNCLRRCFDLDTFSSLRNDVISITRSGIEQWLEKRTPSQIKALMKDVESPLEIDDEIC
FT                   RFKLMVKRDAKVKLDSSCLTKHSAAQNIMFHRKSINAIFSPIFNEVKNRIMCCLKPNIK
FT                   FFTEMTNRDFASIVSNMLGDDDVYHIGEVDFSKYDKSQDAFVKAFEEVMYKELGVDEEL
FT                   LAIWMCGERLSIANTLDGQLSFTIENQRKSGASNTWIGNSLVTLGILSLYYDVRNFEAL
FT                   YISGDDSLIFSRSEISNYADDICTDMGFETKFMSPSVPYFCSKFVVMCGHKTFFVPDPY
FT                   KLFVKLGAVKEDASMDFLFEVFTSFKDLTTDFNDERLIQKLAELVAVKYEVQTGNTTLA
FT                   LNVIHCLRSNFLSFSKLYPRVKGWQVLYTSVKKALFKSGCSFFDSYMTPFGQAVMVWDD
FT                   E"
FT   gene            10358. .10528
FT                   /gene="ORF2"
FT   CDS             10358. .10528
FT                   /codon_start=1
FT                   /gene="ORF2"
FT                   /product="6.3 kDa small hydrophobic protein"
FT                   /protein_id="AAX31605.1"
FT                   /translation="MNQVLQFECLFLLNLAVFAVTFIFILLVIRVIKSFRQKSHEAPNP
FT                   VVRSGGFSTVV"
FT   gene            10544. .12343
FT                   /gene="ORF3"
FT   CDS             10544. .12343
FT                   /codon_start=1
FT                   /note="HSP70h"
FT                   /gene="ORF3"
FT                   /product="heat shock protein-70-like protein"
FT                   /protein_id="AAX31606.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGRVFSFKQNNSAYIPTYLYLFSDSN
FT                   HMTFGYEAESLMSNLKVRGSFYRDLKRWVGCDSSNLDEYLDRLKPHYSVRLIKIGSGLN
FT                   ETVSIGSFGGTVRSEVHLPGLIALFIKAIVGCAENAFACTCTGIICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMINEPSAAALSVCNSIGRKSANLAVYDFGGGTFNVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRAFLTHLFSLTSLEPDLTLDISNLKESLSKTDAEIVYTLRGI
FT                   DGRKEDVRVNKNILTSVMLPYVNRTLKILDSTLKSYARSMNESAQIKCDLVLIGGSSYL
FT                   PGLADVLKKHRSVDRVLRVSDPRAAVAVGCALYSSCLSGSGGLLLIDCAAHTVAIADRS
FT                   CHQIVCAPAGAPIPFSGSMPLYLARANKNSQREIAVFEGEYVKCPKNRKICGANVKFFD
FT                   IGVASTSYEPVTFYMDFSISSVGAISFVVRGPEGKQVSLTGTPAYNFSSVALGSRSVRE
FT                   LHISLNNKVFLGLLLHRKADRRILFTKDEAIRYTESIDIVDVLKEYKSYAASALPPDED
FT                   VEPLLGKSVQKVLRGSRLEEIPL"
FT   gene            12270. .13928
FT                   /gene="ORF4"
FT   CDS             12270. .13928
FT                   /codon_start=1
FT                   /gene="ORF4"
FT                   /product="63 kDa protein"
FT                   /protein_id="AAX31607.1"
FT                   /translation="MSNHSWESLFKKFYGEADWKRYLSRSIAAHSSEIKNLPEIRLYGG
FT                   RVVKKSEFESAAPNSFEQELGLFILSEREVGWSKLCGITVEEAAYDLTNPKAYKFTAEI
FT                   CSPDVKSEGQKYTMEDVMNFMRLSNLDVNDKTLAEQCWSLSNSCGELINPDDKGRFVAL
FT                   TFKDRDIIDDAGAANVECRVGDYLVYAMSLFEQRTQKSQSGNISLYEKYCEYIRTYLGS
FT                   TDLFFTAPDRNPLLTGILYDFCKEYNVFYSSYKNNVDNFRFFLANYMPLISDIFVFQWV
FT                   KPAPDVRLLFELNAAELTLEVPTLSLIDSQVVVGHILRYVESYTSDPAIDALEDKLEAI
FT                   LKTSNPHLSTAQLWVGFFCYYGEFRTAQSRVVQRPGVYKTPDSVGGFEINMKDVEKFFD
FT                   KLQRELPNVSLRRQFNGARAHEAFKIFKNGNISFKPISRLNVPREFWYLNVDYFRHANR
FT                   SGLTEEETLILNNISVDVRKLCAERACSTLPSAKRFSKNHKSNIQSSRQERRIKDPLVA
FT                   LKDTLYEFQHKRAGWGSRSTRDLGSRADHAKRGGG"
FT   gene            13837. .14508
FT                   /gene="CPm"
FT   CDS             13837. .14508
FT                   /codon_start=1
FT                   /gene="CPm"
FT                   /product="minor capsid protein"
FT                   /protein_id="AAX31608.1"
FT                   /translation="MSSNTSVPVGGLEALETSGVVLTTRKEAVDKFFNELKNENYSSVD
FT                   SSRLSDSEVKEVLEKSKESFKSELASTDEHFVYHVIFFLIRCAIISTSEKVKYVGSHKY
FT                   VVDGKTYTVLDAWVFNMMKSLTKKYKRVNSLRAFCCACEDLYLTVAPMMSERFKTKAIG
FT                   MKGLPVGKEYLGADFLSGTSKLMSDHDRAISIVAAKNAVDRSAFTGGERKIVSLYDLGR
FT                   Y"
FT   gene            14579. .15175
FT                   /gene="CP"
FT   CDS             14579. .15175
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major capsid protein"
FT                   /protein_id="AAX31609.1"
FT                   /translation="MELMSDDNLGNLVITDASSLNGVDKKLLSAEIIKMLVQKGAPNDG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNRFGESNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
FT   gene            15175. .15660
FT                   /gene="ORF7"
FT   CDS             15175. .15660
FT                   /codon_start=1
FT                   /gene="ORF7"
FT                   /product="19 kDa protein"
FT                   /protein_id="AAX31610.1"
FT                   /translation="MENYEEKSESLVLLRTNLNTMLLVVKSDASVELPKLLICGYLRVS
FT                   GRGEVTCCNREDLTRDFEGNHHTVIRSRTIQYDSESAFEEFNNSDCVVKFFLETGSVFW
FT                   FFLRSETKGRAVRHLRTFFEANNFFFGSHCGTMEYCLKQVLTETESIIDSFCEERNR"
FT   gene            15662. .16279
FT                   /gene="ORF8"
FT   CDS             15662. .16279
FT                   /codon_start=1
FT                   /gene="ORF8"
FT                   /product="24 kDa protein"
FT                   /protein_id="AAX31611.1"
FT                   /translation="MRVIVSPYEAEDILKKSTDILRDIDSGVLNTKECIKVFSTITRDL
FT                   HCAKASYQWGVDTGLYQRDCAEKRLIDTVESNIRLAQPLVRQKVAAHFCKDEPKELVAF
FT                   ITRKYVELTGVGIRDVVKMEMRSLTRAVLNKLSLEMAFYVSPRAWKNAEWLELKFSPVK
FT                   IFRDLLLDVETLNELCAEDDVHVKKINEIEDENHDLELQEEC"
XX
SQ   Sequence 16494 BP; 4161 A; 3375 C; 4218 G; 4740 T; 0 other;

AY881628  Length: 16494  August 9, 2005 08:40  Type: N  Check: 9593  ..

       1  atattctgtt ggctttcatc tgtgcttgtg cttcggttca atcacactct
      51  gaaagtttca gttccccgga atttcggttt tcttcagaaa cctcattctt
     101  acaggatgtc tagcctagct atctctaccc ttccctgctc ggttgctcaa
     151  ttgagctttg gtcagcctgt tgccgcggtt gccaagtcat ttttgatgac
     201  ttcccttccg tcccttcaga cttatccatc tctgtctgag ttgacttcct
     251  tttctttttg ttttggtgtt ttccaaaatt taaaaatgtt tatgtctttc
     301  ctgcgttcgg tgcacgtttt tgcatctttt tctgagcttt ccacgtttgg
     351  ttcatgctat gaattcattc gcttaggagg tggtgctcat cctctcttct
     401  tttgttcctt ccaatgcgga cctttgtccg tttctctggg tcttgttaac
     451  ggtgttttcg ctgttttaaa cctctccttt ccctttttaa gtaacgcgtc
     501  tctcttgatg gatgtcggaa aagatgtagt tcaagtaaaa agaaaaattt
     551  ccaagcttga gaagaagcag aagaagcgtg ttttttcgat ggctcgcgct
     601  gccgcgcgtt atgtgccttc cccacgcaat cctaaggaga agcgtgctgt
     651  tcatgtacag cctctcccta gtggttcttt tcgattttcc caagacaaaa
     701  acaaaacaga actaatcatc ttaagcaagg aagcgggttt ggtcgcacgc
     751  gttaagtgct cggcgtgcgt tgtgcgccgc cgcggatacg gtggcgcggt
     801  caagagcgta gccctaatag ccctttcccc tttcggcgtg aaattccgtt
     851  gtttcgcgcc gtcttgcagc acatccgctt gtctgaagct tagaatagtg
     901  cgtcgtgttg cagtcggtga ctgccgaggt gagaaggtta tcgcggcgcg
     951  acgtgcggag ctgcagaagc agaatttcaa cagccgtaca ccgaagaagg
    1001  tgcgagagaa ccccgctggc gccctcgagg cgaactcgga agcttctgcc
    1051  acttctaggg tcattttctt cggcagtttc acgcagccct ttgcgttata
    1101  tccgcaccaa gagagcgcga aagcgaacat gcaacatcca ccggtcagtg
    1151  tggtgacggt ggagcgcgcg gttgcgaagg tggctcccga acgaagcgtg
    1201  gtcgacaagg ttcctacgtc cgtaggcgtc tccccgcagc gcggtgtgtt
    1251  ttcccctccg acggtggttc ggaactgcgg tgatatagtt gtaacggggg
    1301  tggtgcatga agccttgaaa aagattaaag atgggctctt gcgcttccgc
    1351  ataggcggtg acatgcgttt ttcgaggttt ttctcctcga attacggctg
    1401  taggttcgtg gcgaacgtgc gcaccaacac tactgtttgg ctgaattgca
    1451  cgaaggcgag tggtgaaaaa ttttcactgg ccgtcgcttg ctcagtggat
    1501  tacgtagcga tgctgcgata cgtgtgtggc gggaagttcc ctctcgtcct
    1551  catgagcaga attaactacc aggatgggca ctgttacctg gcccatatgc
    1601  ggtatctgtg cgccttttac tgtcgcccgt ttagagagtc ggactacgcc
    1651  ctcggatcgt ggccaacggt ggcgcgtctc aaggcatgtg ttgagaaaaa
    1701  cttcggtgtc gaagcttgtg gtatagctct tcgcggctat tacacctctc
    1751  ggaatgttta tcactgcgat tacgactctt cctatatgag gggttttaga
    1801  aatctttccg gccgcgttgg tggtggatcc ttcgatccgt catctctaac
    1851  ttccgtaata acagtgaaga cgagcggtct tccagatagt cgtcctaaaa
    1901  gtatagtgtt cggcgctttt cgctgcgata tacgttatat tgaaccggca
    1951  gactcgggtg gcgtacagtc gagcgctaag atgaaacgag aggaagtacg
    2001  ccgagtcgtg aaaaaatgcg cagcgggcga agctgctgca caatcgcgac
    2051  ggaagaagat agaagagaaa tatcgcgacg gaattcctga tggaggattt
    2101  ccgcatcttt tggccggtaa ccttaatgaa gttaggagga aggtagcggc
    2151  cggggttctg cgattccgcg ttggtggtga tatggatttt catcgctcgt
    2201  tcaccactca ttcaggctat catctgttag tgtggcgccg ctcgagccgg
    2251  agcgtatgca ttgagcttta ctcaccatca aaagcctttt tgcgttacga
    2301  ttttttgcct tgttccgtgg actatgctgc gatgttttct tttgcggcgg
    2351  gtggtcgctt ccctttagtt ctgatgacta gaatcaagta tctaaatggg
    2401  ttctgttatt tagctcattg ccggtatgcg tgcgcgtttt tgttaaaagg
    2451  ttttgacccg aagcgttttg acatcggtgc ttttcccacc gcggcggacc
    2501  ttagaagacg tatggtttcg gtgcttggtg atagaagttt aggcttgaat
    2551  ttgtacggcg cgtacacgtc acgcggcgtt tttcattgtg attacgatgc
    2601  gaagtatata aaagatttac gtcgtatgtc ggcggttata gctggaaagg
    2651  acggggtaga agaggtagtt ccttctgaca taactcctgc tatgaagcag
    2701  aagacgattg aagccgtata tgatagattg tatggcggca ccgactcgtt
    2751  gctgaagctg agcatcgaga aagacttaat cgacttcaaa aacgacgtac
    2801  agagtctgaa gaaagatcga ccaatcgtca aagtcccctt ttacatgtcg
    2851  gaagcaactc agaattcgct gactcgtttc taccctcagt tcgaacttaa
    2901  gttttcgcac tcctcgcatt cagatcaccc tgccgctgcc gcttctagat
    2951  tgctggaaaa cgaaacgtta gtgcgcttgt gtggtaatag cgtttcagat
    3001  attggaggtt gtcctctttt ccacttgaat tctaagactc aaagacgggt
    3051  tcatgtgtgt agacctgtat tggacggcaa agatgcgcag cgtcgcgtgg
    3101  tgcgtgattt acagtattcc aatgtgcgtt cgggagacga cgataaaatt
    3151  ttggaagggc cgcgcaacgt tgatgtctgc cactatcctc tgggtgcttg
    3201  cgaccgcgag agtagcgcta tgatgatggt gcaggtgtac gatgcgtccc
    3251  tttacgagat atgtggtgcc atgatcaaga agaagagtca tataacctac
    3301  ttaaccatgg tcacacccgg cgaatttctt gatggacgcg agtgcgtcta
    3351  catggagtcg ttggactgcg agattgaagt tgatgtgcat gcagacgtcg
    3401  tgatgtacaa gtttggtagc tcgtgctact cgcacaagct ttcagtcatc
    3451  aaggacatta tgaccactcc atacttgatg ttaggcgggt ttctgtttag
    3501  cgtggagatg tatgaagtgc gcatgggcgt gaattacttc aaaatcacga
    3551  agtccgaggt atcgcctagc gttagctgca ccaaactctt gagataccga
    3601  agggctaata gtgacgtggt taaagttaag cttccgcgtt tcgataagaa
    3651  gcgtcgtatg tgcctgcctg ggtatgatac tatataccta gattcaaaat
    3701  ttgtgagtcg cgtgttcgat tatgtcgtgt gtaattgttc cgccgtgaat
    3751  tcgaaaactt tcgagtgggt gtggagtttt attaagtcta gtaagtcgag
    3801  ggtgattatt agcggtaaaa taattcacaa ggacgtgaat ttggacctca
    3851  agtacgtcga gagttttgcc gcggttatgt tggcctctgg cgtgcgcagt
    3901  agactagcgt ccgagtacct cgctaagaac ctcagtcatt tttcgggaga
    3951  ttgctccttc attgaagcaa catctttcgt gttgcgtgaa aaaatcagaa
    4001  atatgactct gaactttaac gaaagacttt tgcagttggt gaaacgtgtt
    4051  gcctttgcaa ccttggatgt gagcttttta gatttagatt cgactcttga
    4101  atcaataaca gattttgccg aatgtaaagt ggcagttgaa ctcgacgagt
    4151  tgggttgctt gagagcggaa gccgagaatg aaaaaattag gaatctggcg
    4201  ggagattcta tcgcggctaa gctcgcgagt gagatagtgg ttgacatcga
    4251  ctctaaacct ccgttgaggc agatgagtaa ctcatcatcc gaaaatgttg
    4301  ataagcggga aattcagaga cccggattgc gtggtggttc tagaatcggg
    4351  gttgttgggg agttccttca cttcgttgta agttctgctt tacgtatttt
    4401  taaatacgcg acggatcagc aacggattaa gtcttacgtg cgctttttgg
    4451  attcagcggt ttccttctta gattacaatt acgagaatct gtcgtttata
    4501  atgcaagtac tttcgaaagg ttattcgtgt atgttcacgt tttttgcgaa
    4551  tcgcggcgac gtatccagtc gcatccgtag cgcggtatgt gctgtgaaag
    4601  aagtagctgc ctcgtgcgcg agcgcgagcg tttctaaagc taaggtcatg
    4651  atcaccttcg cagcagccgt gtgcgctatg atgtttaata gctgcggttt
    4701  ttcaggcgat ggtcgggagt ataaatcgta cgtacatcgt tacacacagg
    4751  tattgtttga cactatattt tttgaggaca gcagttactt acccatagaa
    4801  gttttaagtt cggcgatatg cggtgctatc gtcacgcttt tctcctcggg
    4851  cgcgtccgta agtttaaatg ctttcttgct tcaaattacc aaagggttct
    4901  ccttagaggt tgtcgtccga aatgttgtac gcgtcacgca tggtttgagc
    4951  accacggcga ctgacggcgt tatacgtggg gtgttctccc aaattatgtc
    5001  tcacttactt gtcggaagta ctggtaacgt ggcttaccag ttggccttca
    5051  ttgccggggt agtgcctctt ttagtcaaaa agtgcgtgag cttaattttt
    5101  atcatgcgtg aagataccta ctccggtttt attaagcacg gaatcagtga
    5151  gttttctttt cttagtagtg ttctgacgtt tttgaagggt aagctcgtgg
    5201  atgagttgaa atcggttatt caaggggttt ttgaatccaa caagcacgtg
    5251  tttaaagaag ccactcagga agcgattcgc acgacggtca tgcaagtacc
    5301  tgtcgccgtg gtggatgcgc ttaagtgcgc cgcaggaaga gtttataata
    5351  gttttgctag tcgacgtacc tttggtaagg ataacggctc ttctagcgaa
    5401  gacgcatgcg aagagtactt ttcgtgcgac gaaggtgatg gcccaggtct
    5451  gaaaggaggt tccagctatg gcttctcagt tttagcgttc ttttcacgca
    5501  ttatttgggg tgctcgtcgg tttattgcta aaatgaagca tgagtgcttt
    5551  gggaagcttt ttgatttcct atcgctcagg cttcacgagt tcaggactcg
    5601  cgttttcggg aagaatagag cggacgtggg agtttacgat ttcttgccca
    5651  cggacatcgt ggaaacactc tcatcgatag aagagtgcga ccagattgaa
    5701  gagctactcg gtgatgacct gaatggtgtc aaggatgatt cgttgaccga
    5751  tatgagttac tttgagttct cagaagactt tttggcgtct gttgaggagc
    5801  ctcctttcgc cgggctgcga ggaggtagca agaacgtaac gattttggcg
    5851  attttggaat acgtgtataa tttgtttcgt attgtcgcca acaagtgttc
    5901  aaaaggacct ttattggttg ctttcgctga actttcaagc gccctaatcg
    5951  agaggtttaa agggaaattt tctcgtaaga acaaaatatt tactattgtg
    6001  cgcgagtacg ctctgagttc cctccgatgt cgcatgcgcg cgttgggctt
    6051  gaacaacgat ttcgtggtga attctttcgc tgatttgcta cctatgttgg
    6101  tgaagcggaa ggtttcgaat tcattcttaa gtagcgttta tcgcccaatc
    6151  aaaagtttct catatatgtg tgcttcagcg gagcgacgcg agaaattttt
    6201  agctctcgtg tgtttagtcg ggttaagtct tcctttcttc gtgcgcattg
    6251  taggtgcgaa ggcgtgcgag gagctcgtgt cttcagcacg tcgtttttgt
    6301  gagcgcgtta aagtttttct aaaacagaag tgtgtctctc ttcttagctt
    6351  tttaagttgt ttatttttct ctgatgctgg tgatagctcc gcatccgcgg
    6401  ggctgagggg tggcgcgtcg cgagtgacgc tattccacct cttcgttcgc
    6451  ctcgcgagtg ctcttttatc tttagggtgg gaagggctga agctactcct
    6501  atcgcaccat aacctattat ttttatgttt tgcgatggtc gacgatgtga
    6551  acgtctttgt caaggctttg gggggtcttt ctttctttgt gcaaccggtt
    6601  tcttccgtgt tcgcagcagt acttttgcaa ccggacagat tcgcggggta
    6651  ctccgagaag cttgttacag ctttcgaatt catcctaaag tgttcgcctc
    6701  gcgcgcctgc gctactcaaa acgttttttg agggcgtggc gaacagtact
    6751  gtatcaaaaa ccgttcgaaa acttcttcga ttcttagtga ggaagtttaa
    6801  gcttcgaaaa agaggagggt tgcgtgcaga cggtaagggt tttcaccggc
    6851  agaaagctgt gcccgtcata ccttctaatc ggatcacgac tgacggagtt
    6901  gaaaggcttt cggtgaagat gcaaggagtt gaggcgttgc gtaccgaatt
    6951  gagagtctta gaagatttgg attccgccgt aatcgaaaaa ctcaacagac
    7001  gcagaaatcg tgatactagt gatgacgaat tcacgcgccc tgcttatgag
    7051  cagatacaag aagttaccac tttctgttcg aaagctaact ctgcaggttt
    7101  ggccctggaa agagcagtgc ttgtagaaga cgccgtgaag tcggaaaaac
    7151  tttctaagac tattgacgag atggcgagaa aaggggcgac tactagtgac
    7201  gaagtagcag ttgctttatc tgacgatgaa gccgtggaag aaatctccgt
    7251  tgctgaagag cgagacgatt cgcctaagac ggtcaggatg agcgaatacc
    7301  tgaacaggtt aaattcaagc ttcgagtttc cgaagcctat tattgtagac
    7351  gacaataagg ataccggggg tctaacgaac gctgtgaggg agttttatta
    7401  tatgcaggaa cttgctcttt tcgaaattca cagcaagctg tgtacctact
    7451  atgaccaact gcgcatagtg aacttcgatc gatccgtggc accgtgcagc
    7501  gaggatgctc agctgtacgt acggaagagc ggctcaacga tagtgcaggg
    7551  taaagaagcg cgtttgcata ttaaggattt ccatgaccac gatttcttgt
    7601  ttgacggaag aatttccata aacaagcggc ggcgaggagg taatgtttta
    7651  taccatgata atcttgcgtt tctagcgagt aatttattct tagctggcta
    7701  ccccttttca agaagcttcg ttttcacgaa ttcatcagtt gatattctcc
    7751  tttacgaagc tccgcccgga ggtggtaaga cgacgacgct aatcgactca
    7801  ttcttgaagg tcttcaagaa gggtgaggtt tccactatga tcttaaccgc
    7851  taacaaaagt tcgcaggttg agatcctaaa gaaagtggag aaagaagtgt
    7901  ctaatatcga atgccaaaaa cgtaaggaca agaggtctcc gaagaaaagc
    7951  atttacacca tcgacgctta tttaatgcat caccgtggtt gtgacgctga
    8001  cgttcttttc atcgatgagt gtttcatggt tcatgcgggc agcgtgctag
    8051  cttgcattga attcacgagg tgccataaag taatgatctt cggtgatagc
    8101  cggcagattc attacattga aaggaatgat ttggacaagt gtttgtatgg
    8151  ggatctcgat aggttcgtgg acttgcaatg tcgggtttat ggtaatgttt
    8201  cataccgttg tccatgggat gtgtgcgctt ggttaagcac agtgtacggc
    8251  aatctgatcg ccaccgtgaa gggtgaaagc gaaggtaaga gcagcatgcg
    8301  cattaacgaa attaattcag tcgacgattt ggtgcccgac atgggttcca
    8351  cgtatctgtg tatgcttcaa tcggagaagt tggaaattag caagcacttc
    8401  attcgcaagg gtttgactaa acttaacgtt ctaacggtgc atgaggcgca
    8451  gggtgagaca tatgcgcgtg tgaatcttgt gcgacttaag tttcaggagg
    8501  atgaaccttt taagtctatc aggcacataa ccgtcgctct ttctcgtcac
    8551  accgacagct taacttacag tgtcttggct gcacgtcggg gcgacgccac
    8601  ttgtgatgcc atccagaagg ctgcggaatt ggtgaacaag tttcgcgttt
    8651  ttcctacatc ttttggcggt agtgtcatca atctcaacgt gaagaaggat
    8701  gtggaagata acagtaggtg caaagcttca tcggcaccac taagcgtaat
    8751  taacgacttt ttgaacgaag ttaatcccgg taccgcagtg attgattttg
    8801  gtgacttgtc cgcggacttc agcactggac cttttgagtg tggagccagc
    8851  ggtatcgttg tgcgggacaa catctcctcc agcagcatca ctgatcacga
    8901  taaacagcgt gtttagcgtc gttcggtcgc aagcgattcc gcgtagaaga
    8951  ccatctctac aggagaatct atattcattt gaagcgcgga attataactt
    9001  ctcgacttgc gaccgttaca catctgcttc aatgttcgga gaggctatgg
    9051  cgatgaactg tcttcgccgt tgtttcgact tggatacctt ttcgtccctc
    9101  cgtaatgacg tgatcagtat cacgcgttcg ggcattgaac agtggctgga
    9151  gaaacgtact cctagtcaga ttaaggcatt aatgaaggat gtcgaatcgc
    9201  ctttggaaat tgacgatgaa atttgtcgtt ttaagttgat ggtgaagcgt
    9251  gacgctaagg tgaagttaga ctcctcttgt ttaactaagc acagcgccgc
    9301  tcaaaatatc atgtttcatc gcaaaagcat caatgctatc ttctctccca
    9351  tctttaatga ggtgaaaaat cggataatgt gctgtcttaa gcctaacata
    9401  aaatttttta ccgagatgac caacagagat tttgcttcta tcgtcagcaa
    9451  tatgctcggc gatgatgatg tgtaccatat aggtgaagtt gacttctcga
    9501  agtacgacaa gtctcaagac gctttcgtga aggctttcga ggaagtaatg
    9551  tataaggaac ttggtgttga tgaagagttg ctggctatct ggatgtgcgg
    9601  tgagcggcta tcgatagcta acactctcga tggtcagttg tcctttacga
    9651  ttgagaatca aaggaagtca ggagcttcaa atacctggat tggtaattct
    9701  ctcgtcactt tgggcatttt aagtctttat tacgacgtta gaaatttcga
    9751  agcgttgtat atctcgggtg atgattcttt aattttttct cgcagtgaga
    9801  tttcgaacta tgccgacgac atatgcactg acatgggttt tgagacaaaa
    9851  tttatgtccc caagtgtccc gtacttctgt tctaaatttg ttgttatgtg
    9901  cggccacaag actttttttg ttcccgaccc gtataagctt tttgtcaagt
    9951  tgggagcggt gaaagaggat gcttcgatgg acttcctttt cgaggttttt
   10001  acctctttta aagatttaac caccgatttt aacgacgagc gcttaattca
   10051  aaaacttgct gaacttgtgg ctgtgaaata tgaagttcaa accggcaaca
   10101  ccaccttggc gttaaatgtg atacattgtt tgcgctcgaa tttcctctcc
   10151  ttcagcaagt tgtatcctcg cgtgaagggg tggcaagttt tatatacgtc
   10201  ggttaagaaa gcgcttttca agagcgggtg ttccttcttc gacagctata
   10251  tgaccccttt cggccaggct gtcatggttt gggacgatga gtagcgctaa
   10301  ctcgagcgct gtttctttgt tcgtgacata caccttgtgt gtcaccgtgc
   10351  atttataatg aatcaggttt tgcagttcga atgtttgttt ctgctgaatc
   10401  tcgcggtttt tgctgtgact ttcattttca ttcttctcgt catccgggtg
   10451  attaagtctt ttcgccagaa gagtcacgaa gcgccgaatc ccgttgtccg
   10501  tagcgggggt ttttcaaccg tggtgtagtc aaaagacgcg catatggtgg
   10551  ttttcggttt ggatttcggc accacattct ctacggtgtg cgtgtataag
   10601  gatggacggg ttttttcatt caagcagaat aattcggcgt acatcccaac
   10651  ttacctctat ctcttttccg attctaacca catgacgttt ggttacgagg
   10701  ctgaatcgtt gatgagtaac ttgaaagtta ggggttcgtt ttatagagat
   10751  ttgaaacgtt gggtgggttg cgattcgagt aacctcgacg aatacctcga
   10801  tcgtttaaaa cctcactact cggtacgctt gattaagatt ggttctggtt
   10851  tgaacgaaac cgtttctatt ggaagcttcg ggggcactgt cagatctgaa
   10901  gttcatctac cggggttgat agcccttttt atcaaggcta tcgttggctg
   10951  tgccgagaac gcgtttgcgt gtacttgcac tgggattatc tgttcggtac
   11001  ccgccaatta cgatagtgtc caaaggaatt ttactgatca gtgcgtttca
   11051  ctcagcggct atcagtgtgt gtatatgatc aacgagcctt cagccgctgc
   11101  actttctgtg tgcaattcga ttggtaggaa gtccgcaaac ttggccgttt
   11151  acgatttcgg tggtgggacc tttaacgtgt ctatcatttc gtatcgcaac
   11201  aacactttcg ttgtgcgagc ttctggaggt gatttaaatc tcggtggaag
   11251  ggatgttgat cgtgcgtttc tcacacatct cttctcctta acatcgttag
   11301  aacctgacct cacgttggat atctcgaatt tgaaagaatc tttgtcaaaa
   11351  acagacgcag agatagttta cactttgaga ggtatcgatg gaagaaagga
   11401  agatgttaga gtaaataaaa acattctcac ttcggtgatg ctcccttatg
   11451  tgaacagaac gcttaagatt ctagattcga ccttaaagtc gtacgctagg
   11501  agtatgaacg aaagtgcgca aatcaagtgc gatttagtgc ttataggagg
   11551  atcgtcatat cttcccggtc tggcggacgt tctgaaaaag catcggagcg
   11601  tcgatcgcgt cttaagggtt tcggatcctc gggctgctgt ggccgtcggt
   11651  tgcgcattat attcttcgtg cctctccgga tccggagggt tattactgat
   11701  cgactgtgcg gctcacaccg tcgctatagc ggacagaagt tgtcaccaaa
   11751  tcgtttgcgc tccagcagga gcaccaatcc cattttcagg gagtatgcct
   11801  ctgtatttgg ctagagctaa caaaaactcg cagcgtgaaa ttgccgtgtt
   11851  tgaaggggaa tacgttaagt gccctaagaa caggaagatc tgtggagcaa
   11901  acgttaaatt ttttgatata ggagtggcga gcacttcgta cgagcctgtc
   11951  accttctata tggatttctc catctcaagc gtaggagcta tttcattcgt
   12001  ggtgagggga cctgagggta agcaagtgtc gctcactggt actccagcgt
   12051  acaacttttc gtctgtggct ctcggatcac gcagtgtccg agaattgcat
   12101  attagtttaa ataataaggt tttcctcggt ttgcttctac atagaaaggc
   12151  ggatcgacga atacttttca ctaaggatga agcgattcga tacaccgaat
   12201  caatcgatat cgtggatgtg ctaaaggaat acaaaagtta cgcggccagt
   12251  gccctaccac cagacgagga tgtcgaacca ctcctgggaa agtctgttca
   12301  aaaagttcta cggggaagca gactggaaga gatacctctc taggagtata
   12351  gcagcacact caagtgaaat taagaatcta ccagaaattc gactgtatgg
   12401  tggtagggtc gtaaagaaat ccgagttcga atcggcggct cctaactctt
   12451  ttgaacagga attaggactg ttcatactaa gcgaacggga ggtgggatgg
   12501  agcaaattat gcggaataac ggtggaggaa gcagcatacg atcttacaaa
   12551  tcccaaagct tacaaattca ctgccgagat atgcagcccg gatgtaaaaa
   12601  gtgaaggaca gaagtatact atggaagacg tgatgaactt catgcgttta
   12651  tcaaatttgg atgttaacga caagacactg gcggaacagt gttggtcgtt
   12701  atccaattcg tgcggcgaat tgatcaatcc agacgataaa gggcggttcg
   12751  tggctctcac ctttaaggac agagacataa ttgatgatgc gggtgccgcc
   12801  aacgtggaat gtcgcgtggg cgattatcta gtttacgcta tgtccctgtt
   12851  tgagcagagg acccagaaat cgcagtctgg caacatctcc ttgtacgaga
   12901  aatactgcga atacatcaga acttacttgg ggagtacgga cctgtttttc
   12951  acggcgccgg ataggaatcc gttacttacg ggtatcctat acgacttttg
   13001  taaagaatat aacgttttct actcgtcata taagaacaat gtcgacaatt
   13051  tcagattctt cttggcgaat tatatgcctt taatatctga catcttcgtc
   13101  tttcagtggg taaaacccgc gccggacgtt cggctgcttt ttgagttgaa
   13151  tgccgcggaa ctaacgttgg aggttcccac actaagcttg atagattctc
   13201  aagtcgtggt gggtcacatt ttaagatacg tagaatctta cacgtcagat
   13251  ccagctatcg acgcgttgga agacaaactg gaagcgatac tgaaaactag
   13301  caatcctcat ctatcgacag cgcaactatg ggttggattc ttttgttact
   13351  atggcgaatt tcgcacggct caaagtagag tagtgcaaag gccaggtgtg
   13401  tataaaacac cagactcagt gggtggattc gaaataaaca tgaaagatgt
   13451  cgagaagttc ttcgataaac ttcagagaga attgcccaat gtatctttgc
   13501  gacgtcagtt taacggagcc agagcgcatg aggctttcaa aatatttaag
   13551  aacggaaaca taagtttcaa acccatatcg cgtttgaatg tgcctagaga
   13601  gttctggtat ttgaatgtag actactttag gcatgcgaat aggtctgggt
   13651  taactgaaga agaaacactc atcctaaaca acataagcgt tgatgttcgg
   13701  aaactatgcg ctgagagagc gtgcagtact ctacctagcg cgaagcgctt
   13751  tagtaagaat cataagagca atatacaatc atcacgccaa gagcggagga
   13801  ttaaagaccc gttggtagcg ctaaaagaca ctttatatga gttccaacac
   13851  aagcgtgccg gttgggggtc tcgaagcact cgagacctcg ggagtcgtgc
   13901  tgaccacgcg aaaagaggcg gtggataaat tctttaacga actgaaaaat
   13951  gaaaattact catcagtcga tagcagccga ttaagtgatt cggaagtgaa
   14001  ggaagtgcta gagaaaagta aagaaagttt caagagtgaa ctggcctcca
   14051  ctgacgagca cttcgtttat cacgtaatat ttttcttaat ccgatgtgct
   14101  ataatatcga cgagtgaaaa agtgaagtac gtcggtagtc ataagtatgt
   14151  ggttgacgga aaaacgtaca ctgttctcga cgcttgggtt ttcaacatga
   14201  tgaaaagtct cacaaagaag tacaaacggg tgaatagttt acgtgctttt
   14251  tgttgcgcgt gcgaagatct atatttgact gtcgcaccga tgatgtcaga
   14301  acgcttcaaa actaaggcca tagggatgaa aggtttgcct gttggaaagg
   14351  agtacttagg tgccgacttt ctttcgggaa ctagcaagct gatgagcgat
   14401  cacgacaggg cgatctccat cgtcgcagcg aaaaacgctg tcgatcgtag
   14451  tgcttttaca ggtggggaaa gaaagatagt tagtttgtat gatctaggga
   14501  ggtactaagc acgttgtgct atagtgcgtg ctataaataa taaaacacta
   14551  gtgcttaagt cgcgcagaga aaaacactat ggagttgatg tctgacgaca
   14601  accttggcaa cctggtgata actgacgcct ctagtctaaa tggtgtcgat
   14651  aagaaacttt tatctgcaga aatcataaaa atgttggtgc agaaaggcgc
   14701  tcctaacgac ggtatagaag tggtgttcgg tctactcctt tacgcgcttg
   14751  cagcgagaac cacgtctcct aaagttcaac gcgccgattc agacgtgatt
   14801  ttttctaacc gttttggaga gagtaacgtg gtagtgacgg agggtgacct
   14851  taagaaggtg ctcgacgggt gcgcacctct cactaggttc actaataaac
   14901  ttagaacctt cggtcgcact ttcactgagg cttacgttga tttttgtatc
   14951  gcgtataagc acaaattacc gcaactcaac gccgcagcgg aattgggaat
   15001  tccggctgaa gattcatact tggctgcaga ttttctgggt acttgcccga
   15051  agctctctga attgcagcaa agcagaaaga tgttcgcgag catgtacgct
   15101  ctaaaaactg aaggtggagt ggtaaataca ccagtgagca atctgcgtca
   15151  gctaggtaga agggaagtta tgtaatggag aattacgaag aaaaatctga
   15201  atcgctcgtg ctgctacgca cgaatttgaa tactatgctt ttagtggtca
   15251  agtctgatgc tagtgttgag ctgcctaaac tactaatttg cggttacttg
   15301  cgagtgtcag gacgtggaga ggtgacgtgt tgcaaccgtg aggatttaac
   15351  gagagatttt gagggcaatc accatacggt tatccgctct agaaccatac
   15401  aatatgacag cgagtctgcc tttgaggaat tcaacaattc tgattgcgta
   15451  gtgaagtttt tcctagagac tggtagtgtc ttttggtttt tcctccgaag
   15501  tgaaactaag ggtagagcgg tgcgacattt gcgcaccttc ttcgaagcta
   15551  acaatttctt ctttgggtcg cattgcggta ccatggagta ttgtttgaag
   15601  caggtactaa ctgaaactga gtctataatc gattcttttt gcgaagaaag
   15651  aaatcgttaa gatgagggtt atagtgtctc cttatgaagc tgaagacatt
   15701  ctgaaaaaat cgactgacat attacgagac atagacagtg gggttttaaa
   15751  tactaaggaa tgtatcaaag tgttctcgac aataacgcga gacctacatt
   15801  gtgcaaaggc ttcttaccag tggggtgtgg acactgggtt gtatcagcgc
   15851  gattgcgctg aaaaacgttt aatcgatacg gtagagtcaa acatacggtt
   15901  ggctcaacct ctcgtgcgcc agaaggtagc ggctcacttt tgtaaagatg
   15951  aaccaaaaga gctagtggcg ttcatcacgc gaaagtacgt ggaactcacg
   16001  ggtgtcggaa taagggatgt ggtaaagatg gaaatgcgct ctcttaccag
   16051  agcagtttta aataaattgt ctttggaaat ggcgttttac gtgtcacccc
   16101  gagcgtggaa aaatgctgag tggttagaac taaagttctc acctgtgaaa
   16151  atctttagag atctactgtt agacgtagaa acactcaacg agttgtgcgc
   16201  cgaagatgat gttcacgtaa agaaaataaa tgaaattgag gacgaaaatc
   16251  acgacctcga acttcaagaa gaatgttaaa cacctattaa gtttaacaaa
   16301  ataactagta aataataaat cgaacgtggg tgtatctacc tgacgtatca
   16351  acttaagctg ttactgagta attaaaccaa caagtgtcgg tgtaatgtgt
   16401  atgttgatgt tgagaaaaat ccgtttgtaa aacggtattt tctcttctat
   16451  atttttaaaa aaaaaaaaaa aaaactgcag ccatcgtaaa gccg