Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone P1A minor coat protein (p27) gene, complete cds.

ACC No: AY896551

Dated: 2005-04-17 | Length: 723 | CRC: -480439793

                !!NA_SEQUENCE 1.0
ID   AY896551   standard; genomic RNA; VRL; 723 BP.
XX
AC   AY896551;
XX
SV   AY896551.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone P1A minor coat protein (p27) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-723
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /country="New Zealand"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-1"
FT                   /specific_host="Citrus aurantifolia"
FT                   /clone="P1A"
FT   gene            1. .723
FT                   /gene="p27"
FT   CDS             1. .723
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5I7F0"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q5I7F0"
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AAW82051.1"
FT                   /translation="MAGYTVLPKIDDKEMDPVSAAVPGKYPDVVEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 213 A; 133 C; 173 G; 204 T; 0 other;

 AY896551  Length: 723  April 26, 2005 08:33  Type: N  Check: 1762  ..

       1  atggcaggtt atacagtact tcctaagatc gatgacaaag aaatggatcc
      51  ggtgagtgcc gctgtgcccg gtaagtatcc ggatgtcgtt gagaaatttg
     101  tggccaatag gtccgtagat gcgttaatag aaggcgttat aagtaagttg
     151  gataccaatt caatatacga ggattccact gaaaaattta ctggtgaata
     201  cttgaaatac gtcatggtta ctatggatac tttcttatta gagaactaca
     251  agacgaaaac ggaagatctg ttggttcact tagctatgat ccaaaagagg
     301  ttgtgcacta tatccacgag tactaaaacc aaatttcgtg ataaaggttg
     351  tattagttac gtgcaagggg gttcgcggta taagttaatg gataaagtag
     401  tttttccttt cattatatcg aaatttaccg acagggagac cccaaacgct
     451  ctacgtaagt atgcttgcac tttcgaggag ttacacttat gtatggctag
     501  gttgagaccg gacttatacg aaaataaaag gacgaccaaa gccgggactc
     551  cgcatttaaa gggctactta tcagccgact ttctttcggg ttctctccca
     601  gggtactccg aacatgagcg aggtatcatt cttcgagcgt ctgagtctat
     651  gttagctaga cgtcaaggtt acgaggaggc aaccgagctt cttaatctac
     701  gcgatttggg taagtactta tag