Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone P3A minor coat protein (p27) gene, complete cds.

ACC No: AY896554

Dated: 2005-04-17 | Length: 723 | CRC: -1058725312

                !!NA_SEQUENCE 1.0
ID   AY896554   standard; genomic RNA; VRL; 723 BP.
XX
AC   AY896554;
XX
SV   AY896554.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone P3A minor coat protein (p27) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-723
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /country="New Zealand"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-3"
FT                   /specific_host="Citrus aurantifolia"
FT                   /clone="P3A"
FT   gene            1. .723
FT                   /gene="p27"
FT   CDS             1. .723
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5EFC2"
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AAW82054.1"
FT                   /translation="MAGYTVLPKVDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLFDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 224 A; 134 C; 161 G; 204 T; 0 other;

  AY896554  Length: 723  April 26, 2005 08:33  Type: N  Check: 106  ..

       1  atggcaggtt atacagtact tcccaaagtt gatgacaaag aaatggatcc
      51  agtaagtgct gctgtacccg gcaaataccc ggacgtcatc gaaaaatttg
     101  tgactaatag gtcggtagac gcgctaatag aaggcgttat aagcaagttg
     151  gacaccaatt cgatatacga agattccact gaaaaattta ctggtgagca
     201  actgaagtat gttatggtta ctatggatac tttcttatta gaaaattaca
     251  aaacgaaaac ggaagatcta ctggttcatc tggctatgat tcagaagagg
     301  ttgtgcacta tatccacgag tactaaaacc aaatttcgtg ataagggttg
     351  tattagttat gtacaagggg gtttacggta taagttattc gataaagtag
     401  tttttccctt tattatatcc aagtttaccg acagggagac cccaaacgct
     451  ctacgtaagt atgcttgtac ctttgaggag ttacacttgt gtatggctag
     501  attaagaccc gacctatacg aaaacaaaag gacaaccaaa gctggaactc
     551  cgcatttaaa aggctacttg tcagctgatt ttcttacggg ttctcttcca
     601  ggatactccg aacatgaacg gggtatcatt cttcgagcgt ctgaatctat
     651  gttagctaga cgtcaaggtt acgaggaggc gaccgagctt cttaacttac
     701  gcgatttggg taagtactta tag