Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone C12B coat protein (p25) gene, complete cds.

ACC No: AY896556

Dated: 2005-04-17 | Length: 672 | CRC: -1501713409

                !!NA_SEQUENCE 1.0
ID   AY896556   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY896556;
XX
SV   AY896556.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone C12B coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-12"
FT                   /specific_host="Citrus sinensis"
FT                   /clone="C12B"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5EFC0"
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AAW82056.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 129 C; 165 G; 180 T; 0 other;

  AY896556  Length: 672  April 26, 2005 08:33  Type: N  Check: 943  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactc tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgatgct
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga