Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone C2E coat protein (p25) gene, complete cds.

ACC No: AY896564

Dated: 2005-04-17 | Length: 672 | CRC: 1018718206

                !!NA_SEQUENCE 1.0
ID   AY896564   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY896564;
XX
SV   AY896564.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone C2E coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-2"
FT                   /specific_host="Citrus aurantifolia"
FT                   /clone="C2E"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5EFB2"
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AAW82064.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTMIAMNDV
FT                   RRLGTQQNAALNRDLFLTLKEKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 119 C; 173 G; 184 T; 0 other;

 AY896564  Length: 672  April 26, 2005 08:33  Type: N  Check: 4767  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gtagttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactatgata gcgatgaacg atgtgcgtcg gttgggtacc
     151  caacagaatg ccgctttgaa tagagatttg tttcttactt tgaaagagaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactcaaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttaaagaagc gaggggctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga