Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone C2D coat protein (p25) gene, complete cds.

ACC No: AY896565

Dated: 2005-04-17 | Length: 672 | CRC: -824669215

                !!NA_SEQUENCE 1.0
ID   AY896565   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY896565;
XX
SV   AY896565.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone C2D coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-2"
FT                   /specific_host="Citrus aurantifolia"
FT                   /clone="C2D"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5EFB1"
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AAW82065.1"
FT                   /translation="MDDETKKLNNKNKETKEGDDVVAAESSFGSLNLHTDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 128 C; 168 G; 180 T; 0 other;

 AY896565  Length: 672  April 26, 2005 08:33  Type: N  Check: 1247  ..

       1  atggacgacg aaacaaagaa attgaataac aaaaacaagg aaacgaagga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acaccgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga