Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone C6C coat protein (p25) gene, complete cds.

ACC No: AY896567

Dated: 2005-04-17 | Length: 672 | CRC: 818042520

                !!NA_SEQUENCE 1.0
ID   AY896567   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY896567;
XX
SV   AY896567.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone C6C coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-6"
FT                   /specific_host="Poncirus trifoliata"
FT                   /clone="C6C"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5EFB5"
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AAW82067.1"
FT                   /translation="MDDETKKLKNKNKEVKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 120 C; 176 G; 185 T; 0 other;

 AY896567  Length: 672  April 26, 2005 08:33  Type: N  Check: 5855  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagtgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacatcgtgt ttaattctaa gggtatcggt aaccgtgcta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga