Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone C9E coat protein (p25) gene, complete cds.

ACC No: AY896570

Dated: 2005-04-17 | Length: 672 | CRC: -1854955772

                !!NA_SEQUENCE 1.0
ID   AY896570   standard; genomic RNA; VRL; 672 BP.
XX
AC   AY896570;
XX
SV   AY896570.1
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone C9E coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   "Characterization of trifoliate resistance-breaking isolates of Citrus
RT   tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Harper S.J., Pearson M.N., Mooney P.A., Dawson T.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="trifoliate orange resistance breaking phenotype"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZRB-9"
FT                   /specific_host="Poncirus trifoliata"
FT                   /clone="C9E"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q5EFA6"
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AAW82070.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGVGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 123 C; 177 G; 181 T; 0 other;

 AY896570  Length: 672  April 26, 2005 08:33  Type: N  Check: 3081  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc atgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtgttggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga